Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5236321..5236946 | Replicon | chromosome |
Accession | NZ_CP127839 | ||
Organism | Klebsiella pneumoniae RYC492 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | QRF73_RS25335 | Protein ID | WP_002882817.1 |
Coordinates | 5236321..5236704 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | QRF73_RS25340 | Protein ID | WP_004150355.1 |
Coordinates | 5236704..5236946 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF73_RS25320 (QRF73_25315) | 5233687..5234589 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
QRF73_RS25325 (QRF73_25320) | 5234586..5235221 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
QRF73_RS25330 (QRF73_25325) | 5235218..5236147 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
QRF73_RS25335 (QRF73_25330) | 5236321..5236704 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF73_RS25340 (QRF73_25335) | 5236704..5236946 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
QRF73_RS25345 (QRF73_25340) | 5237151..5238068 | + | 918 | WP_004895173.1 | alpha/beta hydrolase | - |
QRF73_RS25350 (QRF73_25345) | 5238082..5239023 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
QRF73_RS25355 (QRF73_25350) | 5239068..5239505 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
QRF73_RS25360 (QRF73_25355) | 5239502..5240362 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
QRF73_RS25365 (QRF73_25360) | 5240356..5240955 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T284271 WP_002882817.1 NZ_CP127839:c5236704-5236321 [Klebsiella pneumoniae RYC492]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |