Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4763889..4764405 | Replicon | chromosome |
Accession | NZ_CP127839 | ||
Organism | Klebsiella pneumoniae RYC492 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A483NZA3 |
Locus tag | QRF73_RS23080 | Protein ID | WP_004894697.1 |
Coordinates | 4763889..4764173 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | QRF73_RS23085 | Protein ID | WP_002886901.1 |
Coordinates | 4764163..4764405 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF73_RS23055 (QRF73_23050) | 4759284..4759547 | - | 264 | WP_031280360.1 | PTS sugar transporter subunit IIB | - |
QRF73_RS23060 (QRF73_23055) | 4759677..4759850 | + | 174 | WP_002886906.1 | hypothetical protein | - |
QRF73_RS23065 (QRF73_23060) | 4759853..4760596 | + | 744 | WP_004894691.1 | MurR/RpiR family transcriptional regulator | - |
QRF73_RS23070 (QRF73_23065) | 4760954..4763092 | + | 2139 | WP_023325427.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QRF73_RS23075 (QRF73_23070) | 4763421..4763885 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QRF73_RS23080 (QRF73_23075) | 4763889..4764173 | - | 285 | WP_004894697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF73_RS23085 (QRF73_23080) | 4764163..4764405 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QRF73_RS23090 (QRF73_23085) | 4764483..4766393 | - | 1911 | WP_004894700.1 | PRD domain-containing protein | - |
QRF73_RS23095 (QRF73_23090) | 4766416..4767570 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
QRF73_RS23100 (QRF73_23095) | 4767637..4768377 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11174.05 Da Isoelectric Point: 10.3787
>T284270 WP_004894697.1 NZ_CP127839:c4764173-4763889 [Klebsiella pneumoniae RYC492]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIMQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483NZA3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |