Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4672233..4672936 | Replicon | chromosome |
| Accession | NZ_CP127839 | ||
| Organism | Klebsiella pneumoniae RYC492 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | QRF73_RS22655 | Protein ID | WP_004216520.1 |
| Coordinates | 4672233..4672574 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | QRF73_RS22660 | Protein ID | WP_040196448.1 |
| Coordinates | 4672595..4672936 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF73_RS22630 (QRF73_22625) | 4668810..4669937 | + | 1128 | WP_023325431.1 | PAAR domain-containing protein | - |
| QRF73_RS22635 (QRF73_22630) | 4669957..4670190 | + | 234 | WP_014908049.1 | hypothetical protein | - |
| QRF73_RS22640 (QRF73_22635) | 4670336..4670470 | + | 135 | Protein_4440 | transposase | - |
| QRF73_RS22645 (QRF73_22640) | 4670483..4670593 | - | 111 | Protein_4441 | DUF4102 domain-containing protein | - |
| QRF73_RS22650 (QRF73_22645) | 4670968..4671975 | - | 1008 | WP_004216518.1 | restriction endonuclease | - |
| QRF73_RS22655 (QRF73_22650) | 4672233..4672574 | - | 342 | WP_004216520.1 | TA system toxin CbtA family protein | Toxin |
| QRF73_RS22660 (QRF73_22655) | 4672595..4672936 | - | 342 | WP_040196448.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRF73_RS22665 (QRF73_22660) | 4672947..4673489 | - | 543 | WP_004894621.1 | DNA repair protein RadC | - |
| QRF73_RS22670 (QRF73_22665) | 4673502..4673945 | - | 444 | WP_004894623.1 | antirestriction protein | - |
| QRF73_RS22675 (QRF73_22670) | 4673976..4674797 | - | 822 | WP_040196452.1 | DUF932 domain-containing protein | - |
| QRF73_RS22680 (QRF73_22675) | 4674896..4675126 | - | 231 | WP_014226751.1 | DUF905 domain-containing protein | - |
| QRF73_RS22685 (QRF73_22680) | 4675198..4675647 | - | 450 | WP_004215773.1 | IrmA family protein | - |
| QRF73_RS22690 (QRF73_22685) | 4675644..4676096 | - | 453 | WP_040196455.1 | hypothetical protein | - |
| QRF73_RS22695 (QRF73_22690) | 4676133..4676702 | - | 570 | WP_040196457.1 | hypothetical protein | - |
| QRF73_RS22700 (QRF73_22695) | 4676702..4677406 | - | 705 | WP_040196458.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4664683..4711976 | 47293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12805.76 Da Isoelectric Point: 7.1648
>T284269 WP_004216520.1 NZ_CP127839:c4672574-4672233 [Klebsiella pneumoniae RYC492]
MKTLPATTPQAVTLCLSPLAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAVTLCLSPLAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12829.33 Da Isoelectric Point: 5.4792
>AT284269 WP_040196448.1 NZ_CP127839:c4672936-4672595 [Klebsiella pneumoniae RYC492]
MKSTDSENDSFLQWGLNRNVTPCFGARLVQEGNRLHYLVDRASITGDFSNAESLKLDEVFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAIYPTQR
MKSTDSENDSFLQWGLNRNVTPCFGARLVQEGNRLHYLVDRASITGDFSNAESLKLDEVFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAIYPTQR
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|