Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4035750..4036369 | Replicon | chromosome |
| Accession | NZ_CP127839 | ||
| Organism | Klebsiella pneumoniae RYC492 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QRF73_RS19615 | Protein ID | WP_002892050.1 |
| Coordinates | 4036151..4036369 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | QRF73_RS19610 | Protein ID | WP_002892066.1 |
| Coordinates | 4035750..4036124 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF73_RS19600 (QRF73_19595) | 4030902..4032095 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QRF73_RS19605 (QRF73_19600) | 4032118..4035264 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QRF73_RS19610 (QRF73_19605) | 4035750..4036124 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| QRF73_RS19615 (QRF73_19610) | 4036151..4036369 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QRF73_RS19620 (QRF73_19615) | 4036528..4037094 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| QRF73_RS19625 (QRF73_19620) | 4037066..4037206 | - | 141 | WP_032409038.1 | hypothetical protein | - |
| QRF73_RS19630 (QRF73_19625) | 4037227..4037697 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| QRF73_RS19635 (QRF73_19630) | 4037672..4039123 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| QRF73_RS19640 (QRF73_19635) | 4039224..4039922 | + | 699 | WP_004893822.1 | GNAT family protein | - |
| QRF73_RS19645 (QRF73_19640) | 4039919..4040059 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| QRF73_RS19650 (QRF73_19645) | 4040059..4040322 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T284267 WP_002892050.1 NZ_CP127839:4036151-4036369 [Klebsiella pneumoniae RYC492]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT284267 WP_002892066.1 NZ_CP127839:4035750-4036124 [Klebsiella pneumoniae RYC492]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |