Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4035750..4036369 Replicon chromosome
Accession NZ_CP127839
Organism Klebsiella pneumoniae RYC492

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QRF73_RS19615 Protein ID WP_002892050.1
Coordinates 4036151..4036369 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QRF73_RS19610 Protein ID WP_002892066.1
Coordinates 4035750..4036124 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF73_RS19600 (QRF73_19595) 4030902..4032095 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QRF73_RS19605 (QRF73_19600) 4032118..4035264 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QRF73_RS19610 (QRF73_19605) 4035750..4036124 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QRF73_RS19615 (QRF73_19610) 4036151..4036369 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QRF73_RS19620 (QRF73_19615) 4036528..4037094 + 567 WP_002892030.1 maltose O-acetyltransferase -
QRF73_RS19625 (QRF73_19620) 4037066..4037206 - 141 WP_032409038.1 hypothetical protein -
QRF73_RS19630 (QRF73_19625) 4037227..4037697 + 471 WP_002892026.1 YlaC family protein -
QRF73_RS19635 (QRF73_19630) 4037672..4039123 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QRF73_RS19640 (QRF73_19635) 4039224..4039922 + 699 WP_004893822.1 GNAT family protein -
QRF73_RS19645 (QRF73_19640) 4039919..4040059 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QRF73_RS19650 (QRF73_19645) 4040059..4040322 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T284267 WP_002892050.1 NZ_CP127839:4036151-4036369 [Klebsiella pneumoniae RYC492]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT284267 WP_002892066.1 NZ_CP127839:4035750-4036124 [Klebsiella pneumoniae RYC492]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References