Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 781077..781734 | Replicon | chromosome |
Accession | NZ_CP127839 | ||
Organism | Klebsiella pneumoniae RYC492 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | QRF73_RS03880 | Protein ID | WP_002916310.1 |
Coordinates | 781324..781734 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QRF73_RS03875 | Protein ID | WP_002916312.1 |
Coordinates | 781077..781343 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF73_RS03850 (QRF73_03850) | 776095..777528 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
QRF73_RS03855 (QRF73_03855) | 777785..778513 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
QRF73_RS03860 (QRF73_03860) | 778563..778874 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
QRF73_RS03865 (QRF73_03865) | 779038..779697 | + | 660 | WP_004889817.1 | hemolysin III family protein | - |
QRF73_RS03870 (QRF73_03870) | 779848..780831 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
QRF73_RS03875 (QRF73_03875) | 781077..781343 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QRF73_RS03880 (QRF73_03880) | 781324..781734 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
QRF73_RS03885 (QRF73_03885) | 781741..782262 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
QRF73_RS03890 (QRF73_03890) | 782363..783259 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QRF73_RS03895 (QRF73_03895) | 783282..783995 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QRF73_RS03900 (QRF73_03900) | 784001..785734 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T284260 WP_002916310.1 NZ_CP127839:781324-781734 [Klebsiella pneumoniae RYC492]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |