Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1234627..1235544 | Replicon | chromosome |
Accession | NZ_CP127834 | ||
Organism | Bacillus velezensis strain Ag109 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NSY31_RS06470 | Protein ID | WP_032866111.1 |
Coordinates | 1234798..1235544 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NSY31_RS06465 | Protein ID | WP_003154807.1 |
Coordinates | 1234627..1234797 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NSY31_RS06430 (NSY31_06430) | 1229852..1231483 | + | 1632 | WP_060561803.1 | pyocin knob domain-containing protein | - |
NSY31_RS06435 (NSY31_06435) | 1231496..1231867 | + | 372 | WP_060561802.1 | XkdW family protein | - |
NSY31_RS06440 (NSY31_06440) | 1231872..1232069 | + | 198 | WP_059367156.1 | XkdX family protein | - |
NSY31_RS06445 (NSY31_06445) | 1232126..1232886 | + | 761 | Protein_1208 | phage portal protein | - |
NSY31_RS06450 (NSY31_06450) | 1232938..1233201 | + | 264 | WP_098081338.1 | hemolysin XhlA family protein | - |
NSY31_RS06455 (NSY31_06455) | 1233215..1233478 | + | 264 | WP_003154813.1 | phage holin | - |
NSY31_RS06460 (NSY31_06460) | 1233492..1234370 | + | 879 | WP_043021264.1 | N-acetylmuramoyl-L-alanine amidase | - |
NSY31_RS06465 (NSY31_06465) | 1234627..1234797 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NSY31_RS06470 (NSY31_06470) | 1234798..1235544 | - | 747 | WP_032866111.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NSY31_RS06475 (NSY31_06475) | 1235649..1236647 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
NSY31_RS06480 (NSY31_06480) | 1236660..1237277 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NSY31_RS06485 (NSY31_06485) | 1237563..1238879 | - | 1317 | WP_007610842.1 | amino acid permease | - |
NSY31_RS06490 (NSY31_06490) | 1239202..1240152 | + | 951 | WP_098081339.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29095.60 Da Isoelectric Point: 4.7755
>T284256 WP_032866111.1 NZ_CP127834:c1235544-1234798 [Bacillus velezensis]
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|