Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 490685..491322 | Replicon | chromosome |
Accession | NZ_CP127834 | ||
Organism | Bacillus velezensis strain Ag109 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NSY31_RS02485 | Protein ID | WP_003156187.1 |
Coordinates | 490972..491322 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NSY31_RS02480 | Protein ID | WP_003156188.1 |
Coordinates | 490685..490966 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NSY31_RS02460 (NSY31_02460) | 487050..487649 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NSY31_RS02465 (NSY31_02465) | 487742..488107 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
NSY31_RS02470 (NSY31_02470) | 488272..489279 | + | 1008 | WP_098081024.1 | outer membrane lipoprotein carrier protein LolA | - |
NSY31_RS02475 (NSY31_02475) | 489396..490565 | + | 1170 | WP_098081026.1 | alanine racemase | - |
NSY31_RS02480 (NSY31_02480) | 490685..490966 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NSY31_RS02485 (NSY31_02485) | 490972..491322 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NSY31_RS02490 (NSY31_02490) | 491440..492261 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NSY31_RS02495 (NSY31_02495) | 492266..492631 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NSY31_RS02500 (NSY31_02500) | 492634..493035 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NSY31_RS02505 (NSY31_02505) | 493047..494054 | + | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
NSY31_RS02510 (NSY31_02510) | 494118..494447 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NSY31_RS02515 (NSY31_02515) | 494444..494926 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
NSY31_RS02520 (NSY31_02520) | 494892..495680 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NSY31_RS02525 (NSY31_02525) | 495680..496282 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284255 WP_003156187.1 NZ_CP127834:490972-491322 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|