Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 866887..867523 | Replicon | chromosome |
| Accession | NZ_CP127833 | ||
| Organism | Bacillus mojavensis strain KRS009 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | QLQ02_RS04395 | Protein ID | WP_003156187.1 |
| Coordinates | 866887..867237 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | QLQ02_RS04400 | Protein ID | WP_003225183.1 |
| Coordinates | 867242..867523 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ02_RS04355 (861929) | 861929..862528 | - | 600 | WP_010333121.1 | phosphoserine phosphatase RsbX | - |
| QLQ02_RS04360 (862528) | 862528..863316 | - | 789 | WP_010333120.1 | RNA polymerase sigma factor SigB | - |
| QLQ02_RS04365 (863282) | 863282..863764 | - | 483 | WP_010333119.1 | anti-sigma B factor RsbW | - |
| QLQ02_RS04370 (863761) | 863761..864090 | - | 330 | WP_268444340.1 | anti-sigma factor antagonist RsbV | - |
| QLQ02_RS04375 (864152) | 864152..865159 | - | 1008 | WP_010333117.1 | phosphoserine phosphatase RsbU | - |
| QLQ02_RS04380 (865171) | 865171..865572 | - | 402 | WP_010333116.1 | serine/threonine-protein kinase RsbT | - |
| QLQ02_RS04385 (865576) | 865576..865941 | - | 366 | WP_010333115.1 | RsbT antagonist protein RsbS | - |
| QLQ02_RS04390 (865946) | 865946..866770 | - | 825 | WP_081720860.1 | RsbT co-antagonist protein RsbRA | - |
| QLQ02_RS04395 (866887) | 866887..867237 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QLQ02_RS04400 (867242) | 867242..867523 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| QLQ02_RS04405 (867641) | 867641..868810 | - | 1170 | WP_168746988.1 | alanine racemase | - |
| QLQ02_RS04410 (868927) | 868927..869943 | - | 1017 | WP_081720864.1 | outer membrane lipoprotein carrier protein LolA | - |
| QLQ02_RS04415 (870109) | 870109..870474 | - | 366 | WP_010333111.1 | holo-ACP synthase | - |
| QLQ02_RS04420 (870569) | 870569..871168 | + | 600 | WP_286059014.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T284254 WP_003156187.1 NZ_CP127833:c867237-866887 [Bacillus mojavensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|