Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 7937..8853 | Replicon | chromosome |
Accession | NZ_CP127833 | ||
Organism | Bacillus mojavensis strain KRS009 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QLQ02_RS00035 | Protein ID | WP_268471127.1 |
Coordinates | 7937..8683 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A6H2JPH3 |
Locus tag | QLQ02_RS00040 | Protein ID | WP_010333922.1 |
Coordinates | 8683..8853 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ02_RS00015 (3259) | 3259..4209 | - | 951 | WP_229147973.1 | ring-cleaving dioxygenase | - |
QLQ02_RS00020 (4604) | 4604..5920 | + | 1317 | WP_286058655.1 | serine/threonine exchanger | - |
QLQ02_RS00025 (6196) | 6196..6813 | + | 618 | WP_010333926.1 | DUF47 domain-containing protein | - |
QLQ02_RS00030 (6826) | 6826..7827 | + | 1002 | WP_010333925.1 | inorganic phosphate transporter | - |
QLQ02_RS00035 (7937) | 7937..8683 | + | 747 | WP_268471127.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QLQ02_RS00040 (8683) | 8683..8853 | + | 171 | WP_010333922.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QLQ02_RS00045 (8938) | 8938..9075 | + | 138 | WP_128568473.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QLQ02_RS00050 (9112) | 9112..10005 | - | 894 | WP_168747522.1 | N-acetylmuramoyl-L-alanine amidase | - |
QLQ02_RS00055 (10018) | 10018..10281 | - | 264 | WP_010333919.1 | phage holin | - |
QLQ02_RS00060 (10293) | 10293..10562 | - | 270 | WP_044156228.1 | hemolysin XhlA family protein | - |
QLQ02_RS00065 (10619) | 10619..11458 | - | 840 | WP_286058656.1 | phage portal protein | - |
QLQ02_RS00070 (11502) | 11502..11666 | - | 165 | WP_286058657.1 | XkdX family protein | - |
QLQ02_RS00075 (11663) | 11663..11992 | - | 330 | WP_286058658.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29143.53 Da Isoelectric Point: 4.5470
>T284253 WP_268471127.1 NZ_CP127833:7937-8683 [Bacillus mojavensis]
MLLFFQIMVWCTMAALGFYVYATWRFEAKVKEKMSAIRKTWYLLFVFGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAQGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGFYVYATWRFEAKVKEKMSAIRKTWYLLFVFGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAQGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|