Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2764513..2765107 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | QQ658_RS12835 | Protein ID | WP_286025230.1 |
| Coordinates | 2764805..2765107 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QQ658_RS12830 | Protein ID | WP_286025229.1 |
| Coordinates | 2764513..2764812 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS12810 (QQ658_12810) | 2762035..2763042 | + | 1008 | WP_286027116.1 | dihydroorotate dehydrogenase-like protein | - |
| QQ658_RS12815 (QQ658_12815) | 2763189..2763458 | + | 270 | WP_286025226.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| QQ658_RS12820 (QQ658_12820) | 2763445..2764194 | + | 750 | WP_286025227.1 | hypothetical protein | - |
| QQ658_RS12825 (QQ658_12825) | 2764232..2764513 | - | 282 | WP_286025228.1 | hypothetical protein | - |
| QQ658_RS12830 (QQ658_12830) | 2764513..2764812 | - | 300 | WP_286025229.1 | putative addiction module antidote protein | Antitoxin |
| QQ658_RS12835 (QQ658_12835) | 2764805..2765107 | - | 303 | WP_286025230.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ658_RS12840 (QQ658_12840) | 2765182..2767542 | - | 2361 | WP_286025231.1 | heavy metal translocating P-type ATPase | - |
| QQ658_RS12845 (QQ658_12845) | 2767542..2767748 | - | 207 | WP_286025232.1 | heavy metal-associated domain-containing protein | - |
| QQ658_RS12850 (QQ658_12850) | 2767789..2768103 | - | 315 | WP_286025233.1 | metal-sensitive transcriptional regulator | - |
| QQ658_RS12855 (QQ658_12855) | 2768160..2768690 | + | 531 | WP_286025234.1 | hypothetical protein | - |
| QQ658_RS12860 (QQ658_12860) | 2768714..2769037 | + | 324 | WP_286025235.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11449.01 Da Isoelectric Point: 10.5000
>T284245 WP_286025230.1 NZ_CP127390:c2765107-2764805 [Propionimicrobium sp. PCR01-08-3]
MVEVVKSTTFDRWLTRLRDRQGAGRILARIDRLSAGNRGDAKSVGAGIWELRIDYGPGYRVYYLQRGSRLILLLCGGDKS
SQQRDIENAHRIAREWISNE
MVEVVKSTTFDRWLTRLRDRQGAGRILARIDRLSAGNRGDAKSVGAGIWELRIDYGPGYRVYYLQRGSRLILLLCGGDKS
SQQRDIENAHRIAREWISNE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|