Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2683749..2684380 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQ658_RS12445 | Protein ID | WP_286025156.1 |
| Coordinates | 2683749..2684126 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QQ658_RS12450 | Protein ID | WP_286025157.1 |
| Coordinates | 2684123..2684380 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS12420 (QQ658_12420) | 2678984..2680495 | - | 1512 | WP_286025151.1 | methylmalonyl-CoA carboxytransferase subunit 5S | - |
| QQ658_RS12425 (QQ658_12425) | 2680824..2682722 | + | 1899 | WP_286025152.1 | asparagine synthase (glutamine-hydrolyzing) | - |
| QQ658_RS12430 (QQ658_12430) | 2682816..2683211 | - | 396 | WP_286025153.1 | type II toxin-antitoxin system VapC family toxin | - |
| QQ658_RS12435 (QQ658_12435) | 2683208..2683432 | - | 225 | WP_286025154.1 | toxin-antitoxin system, antitoxin component | - |
| QQ658_RS12440 (QQ658_12440) | 2683528..2683686 | - | 159 | WP_286025155.1 | hypothetical protein | - |
| QQ658_RS12445 (QQ658_12445) | 2683749..2684126 | - | 378 | WP_286025156.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ658_RS12450 (QQ658_12450) | 2684123..2684380 | - | 258 | WP_286025157.1 | CopG family transcriptional regulator | Antitoxin |
| QQ658_RS12455 (QQ658_12455) | 2684586..2685224 | + | 639 | WP_286025158.1 | helix-turn-helix domain-containing protein | - |
| QQ658_RS12460 (QQ658_12460) | 2685217..2685870 | + | 654 | WP_286025159.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QQ658_RS12465 (QQ658_12465) | 2685896..2687065 | - | 1170 | WP_286025160.1 | GAF domain-containing protein | - |
| QQ658_RS12470 (QQ658_12470) | 2687347..2688339 | + | 993 | WP_286025161.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
| QQ658_RS12475 (QQ658_12475) | 2688355..2689371 | + | 1017 | WP_286025162.1 | alpha-ketoacid dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13441.56 Da Isoelectric Point: 6.0724
>T284242 WP_286025156.1 NZ_CP127390:c2684126-2683749 [Propionimicrobium sp. PCR01-08-3]
MSVLIDTSVLIDVLRGHRPAAVVLKTARMNGLLHASEITRLEVLAGMRPSEETSTRALLGALTWHSVDEEVAEIAGELGR
RWLPGNRGIDSADLAIAATATLLDAPILTCNVKHFPMFNGLTAPY
MSVLIDTSVLIDVLRGHRPAAVVLKTARMNGLLHASEITRLEVLAGMRPSEETSTRALLGALTWHSVDEEVAEIAGELGR
RWLPGNRGIDSADLAIAATATLLDAPILTCNVKHFPMFNGLTAPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|