Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
| Location | 2540738..2541423 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQ658_RS11770 | Protein ID | WP_286025033.1 |
| Coordinates | 2540738..2541166 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QQ658_RS11775 | Protein ID | WP_286025034.1 |
| Coordinates | 2541163..2541423 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS11750 (QQ658_11750) | 2536928..2537923 | - | 996 | WP_286025029.1 | glycosyltransferase | - |
| QQ658_RS11755 (QQ658_11755) | 2537968..2538972 | - | 1005 | WP_286025030.1 | glycosyltransferase family 9 protein | - |
| QQ658_RS11760 (QQ658_11760) | 2538969..2539571 | - | 603 | WP_286025031.1 | HAD family hydrolase | - |
| QQ658_RS11765 (QQ658_11765) | 2539646..2540605 | + | 960 | WP_286025032.1 | glycosyltransferase family 9 protein | - |
| QQ658_RS11770 (QQ658_11770) | 2540738..2541166 | - | 429 | WP_286025033.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QQ658_RS11775 (QQ658_11775) | 2541163..2541423 | - | 261 | WP_286025034.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QQ658_RS11780 (QQ658_11780) | 2541600..2544473 | - | 2874 | WP_286025035.1 | cation-translocating P-type ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15293.28 Da Isoelectric Point: 4.5730
>T284241 WP_286025033.1 NZ_CP127390:c2541166-2540738 [Propionimicrobium sp. PCR01-08-3]
MSADSISSPDHGERGLLDTSVFIAQESGRRIDVSLLPDEGYVSVITLAELEAGVLAASDQTIRSRRLATLTRVSALVPLQ
VDATAAAHWARMRVQLAESGRRVNVNDLWIAAVALANGLAVYTQDHDYDPLAELGELRVITV
MSADSISSPDHGERGLLDTSVFIAQESGRRIDVSLLPDEGYVSVITLAELEAGVLAASDQTIRSRRLATLTRVSALVPLQ
VDATAAAHWARMRVQLAESGRRVNVNDLWIAAVALANGLAVYTQDHDYDPLAELGELRVITV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|