Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 2462844..2463394 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QQ658_RS11370 | Protein ID | WP_286024959.1 |
| Coordinates | 2462844..2463116 (-) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QQ658_RS11375 | Protein ID | WP_286024960.1 |
| Coordinates | 2463113..2463394 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS11340 (QQ658_11340) | 2458132..2460483 | + | 2352 | WP_286024953.1 | DEAD/DEAH box helicase | - |
| QQ658_RS11345 (QQ658_11345) | 2460532..2460906 | - | 375 | WP_286024954.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| QQ658_RS11350 (QQ658_11350) | 2460903..2461106 | - | 204 | WP_286024955.1 | hypothetical protein | - |
| QQ658_RS11355 (QQ658_11355) | 2461293..2461658 | - | 366 | WP_286024956.1 | flp pilus-assembly TadE/G-like family protein | - |
| QQ658_RS11360 (QQ658_11360) | 2461697..2462008 | - | 312 | WP_286024957.1 | TadE family type IV pilus minor pilin | - |
| QQ658_RS11365 (QQ658_11365) | 2462177..2462473 | - | 297 | WP_286024958.1 | DUF4244 domain-containing protein | - |
| QQ658_RS11370 (QQ658_11370) | 2462844..2463116 | - | 273 | WP_286024959.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ658_RS11375 (QQ658_11375) | 2463113..2463394 | - | 282 | WP_286024960.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QQ658_RS11380 (QQ658_11380) | 2463629..2464177 | - | 549 | WP_286024961.1 | type II secretion system F family protein | - |
| QQ658_RS11385 (QQ658_11385) | 2464411..2465043 | - | 633 | WP_286024962.1 | pilus assembly protein TadB | - |
| QQ658_RS11390 (QQ658_11390) | 2465220..2466554 | - | 1335 | WP_286024963.1 | TadA family conjugal transfer-associated ATPase | - |
| QQ658_RS11395 (QQ658_11395) | 2466561..2467604 | - | 1044 | WP_286024964.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10473.13 Da Isoelectric Point: 10.5455
>T284240 WP_286024959.1 NZ_CP127390:c2463116-2462844 [Propionimicrobium sp. PCR01-08-3]
VSQRYDVEFTRSARRALTKELPEKVAAAAFEFISGPLRENPYRVGKPLREPLAPLYSARRGEYRVLYLIIDERVVVQVVA
VVHRRDAYKR
VSQRYDVEFTRSARRALTKELPEKVAAAAFEFISGPLRENPYRVGKPLREPLAPLYSARRGEYRVLYLIIDERVVVQVVA
VVHRRDAYKR
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|