Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 2365725..2366374 Replicon chromosome
Accession NZ_CP127390
Organism Propionimicrobium sp. PCR01-08-3

Toxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QQ658_RS10910 Protein ID WP_286024878.1
Coordinates 2365955..2366374 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag QQ658_RS10905 Protein ID WP_286024877.1
Coordinates 2365725..2365958 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQ658_RS10875 (QQ658_10875) 2361690..2362469 + 780 WP_286024871.1 phosphate ABC transporter ATP-binding protein PstB -
QQ658_RS10880 (QQ658_10880) 2362544..2362825 + 282 WP_286024872.1 type II toxin-antitoxin system RelE/ParE family toxin -
QQ658_RS10885 (QQ658_10885) 2362835..2363131 + 297 WP_286024873.1 HigA family addiction module antitoxin -
QQ658_RS10890 (QQ658_10890) 2363189..2363926 + 738 WP_286024874.1 glycerophosphodiester phosphodiesterase family protein -
QQ658_RS10895 (QQ658_10895) 2364040..2364696 + 657 WP_286024875.1 hypothetical protein -
QQ658_RS10900 (QQ658_10900) 2365075..2365611 + 537 WP_286024876.1 GNAT family N-acetyltransferase -
QQ658_RS10905 (QQ658_10905) 2365725..2365958 + 234 WP_286024877.1 toxin-antitoxin system Antitoxin
QQ658_RS10910 (QQ658_10910) 2365955..2366374 + 420 WP_286024878.1 type II toxin-antitoxin system VapC family toxin Toxin
QQ658_RS10915 (QQ658_10915) 2366483..2366614 + 132 WP_286024879.1 hypothetical protein -
QQ658_RS10920 (QQ658_10920) 2366696..2367832 - 1137 WP_286024880.1 YbfB/YjiJ family MFS transporter -
QQ658_RS10925 (QQ658_10925) 2367861..2368268 - 408 WP_286024881.1 carboxymuconolactone decarboxylase family protein -
QQ658_RS10930 (QQ658_10930) 2368265..2369038 - 774 WP_286024882.1 hypothetical protein -
QQ658_RS10935 (QQ658_10935) 2369375..2370436 + 1062 WP_286024883.1 IS110 family transposase -
QQ658_RS10940 (QQ658_10940) 2370527..2371003 - 477 WP_286024884.1 SRPBCC domain-containing protein -
QQ658_RS10945 (QQ658_10945) 2371000..2371317 - 318 WP_286024885.1 metalloregulator ArsR/SmtB family transcription factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-129)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15167.37 Da        Isoelectric Point: 5.1281

>T284239 WP_286024878.1 NZ_CP127390:2365955-2366374 [Propionimicrobium sp. PCR01-08-3]
MIVLDTNVISETIKSRPDARVVSWMETLVGEVAITAITLGELLAGVRRLPDGQRRFQLHMTIDLAVGPYRDTSAILAFDD
DAATHYADVLFAREQAGMPISTADAQIAAICRTHRAICATRNTKDFAQTGVDLVNPWLG

Download         Length: 420 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8331.45 Da        Isoelectric Point: 5.5821

>AT284239 WP_286024877.1 NZ_CP127390:2365725-2365958 [Propionimicrobium sp. PCR01-08-3]
MSSIIVRGLDESVKEQLANQAKRHGRSMEAEARDILAKGVNPPHIGLALMHAAQQIGGIDDLAVPERTDTARAVEFE

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References