Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpIK/MazF(toxin) |
| Location | 2183391..2183959 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | chpK | Uniprot ID | - |
| Locus tag | QQ658_RS09995 | Protein ID | WP_286024709.1 |
| Coordinates | 2183391..2183732 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | chpI | Uniprot ID | - |
| Locus tag | QQ658_RS10000 | Protein ID | WP_286024710.1 |
| Coordinates | 2183726..2183959 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS09970 (QQ658_09970) | 2178596..2179255 | - | 660 | WP_286024704.1 | mismatch-specific DNA-glycosylase | - |
| QQ658_RS09975 (QQ658_09975) | 2179473..2181290 | - | 1818 | WP_286024705.1 | BCCT family transporter | - |
| QQ658_RS09980 (QQ658_09980) | 2181533..2181889 | + | 357 | WP_286024706.1 | hypothetical protein | - |
| QQ658_RS09985 (QQ658_09985) | 2182084..2182770 | - | 687 | WP_286024707.1 | SDR family oxidoreductase | - |
| QQ658_RS09990 (QQ658_09990) | 2182805..2183359 | - | 555 | WP_286024708.1 | GNAT family N-acetyltransferase | - |
| QQ658_RS09995 (QQ658_09995) | 2183391..2183732 | - | 342 | WP_286024709.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QQ658_RS10000 (QQ658_10000) | 2183726..2183959 | - | 234 | WP_286024710.1 | hypothetical protein | Antitoxin |
| QQ658_RS10005 (QQ658_10005) | 2184033..2185106 | - | 1074 | WP_286024711.1 | redox-regulated ATPase YchF | - |
| QQ658_RS10010 (QQ658_10010) | 2185402..2185926 | + | 525 | WP_286024712.1 | DUF4190 domain-containing protein | - |
| QQ658_RS10015 (QQ658_10015) | 2186057..2187349 | - | 1293 | WP_286024713.1 | M18 family aminopeptidase | - |
| QQ658_RS10020 (QQ658_10020) | 2187533..2188666 | - | 1134 | WP_286024714.1 | zinc-binding dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12314.21 Da Isoelectric Point: 6.9804
>T284237 WP_286024709.1 NZ_CP127390:c2183732-2183391 [Propionimicrobium sp. PCR01-08-3]
VVTRGEIWWVDFGDPIGSEPGYRRPALVVSSDRFNRSRIATVIVTALTSNLRLAVMPGNVELEKGEADLPKDCVVNVSQT
LVIDRSRLSQSVGTLSAHLMAKVDEGLRLVLAL
VVTRGEIWWVDFGDPIGSEPGYRRPALVVSSDRFNRSRIATVIVTALTSNLRLAVMPGNVELEKGEADLPKDCVVNVSQT
LVIDRSRLSQSVGTLSAHLMAKVDEGLRLVLAL
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|