Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yoeB-Axe/YoeB-RelB |
| Location | 825982..826505 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | QQ658_RS03885 | Protein ID | WP_286026359.1 |
| Coordinates | 826251..826505 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | Axe | Uniprot ID | - |
| Locus tag | QQ658_RS03880 | Protein ID | WP_286026358.1 |
| Coordinates | 825982..826254 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS03860 (QQ658_03860) | 821055..822332 | + | 1278 | WP_286026354.1 | ATP-dependent Clp protease ATP-binding subunit ClpX | - |
| QQ658_RS03865 (QQ658_03865) | 822401..823846 | + | 1446 | WP_286026355.1 | threonine synthase | - |
| QQ658_RS03870 (QQ658_03870) | 824033..824881 | + | 849 | WP_286026356.1 | lipoyl(octanoyl) transferase LipB | - |
| QQ658_RS03875 (QQ658_03875) | 824897..825901 | + | 1005 | WP_286026357.1 | lipoyl synthase | - |
| QQ658_RS03880 (QQ658_03880) | 825982..826254 | + | 273 | WP_286026358.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QQ658_RS03885 (QQ658_03885) | 826251..826505 | + | 255 | WP_286026359.1 | Txe/YoeB family addiction module toxin | Toxin |
| QQ658_RS03890 (QQ658_03890) | 826639..829197 | - | 2559 | WP_286027025.1 | valine--tRNA ligase | - |
| QQ658_RS03895 (QQ658_03895) | 829341..830201 | - | 861 | WP_286026360.1 | thioredoxin domain-containing protein | - |
| QQ658_RS03900 (QQ658_03900) | 830198..830842 | - | 645 | WP_286026361.1 | DoxX family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10023.35 Da Isoelectric Point: 6.4581
>T284232 WP_286026359.1 NZ_CP127390:826251-826505 [Propionimicrobium sp. PCR01-08-3]
VNLSWTEDAWNDYLYWQEQDKKTLRRINKLISDTMRHPSEGIGKPEPLKWEMQGAWSRRIDTANRLIYVVLDDTVCILSA
KDHY
VNLSWTEDAWNDYLYWQEQDKKTLRRINKLISDTMRHPSEGIGKPEPLKWEMQGAWSRRIDTANRLIYVVLDDTVCILSA
KDHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|