Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 35084..35682 | Replicon | chromosome |
| Accession | NZ_CP127390 | ||
| Organism | Propionimicrobium sp. PCR01-08-3 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | QQ658_RS00160 | Protein ID | WP_286025673.1 |
| Coordinates | 35368..35682 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QQ658_RS00155 | Protein ID | WP_286025672.1 |
| Coordinates | 35084..35377 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQ658_RS00125 (QQ658_00125) | 30881..31327 | + | 447 | WP_286025666.1 | helix-turn-helix transcriptional regulator | - |
| QQ658_RS00130 (QQ658_00130) | 31324..31875 | + | 552 | WP_286025667.1 | hypothetical protein | - |
| QQ658_RS00135 (QQ658_00135) | 31835..33268 | - | 1434 | WP_286025668.1 | PH domain-containing protein | - |
| QQ658_RS00140 (QQ658_00140) | 33427..33966 | - | 540 | WP_286025669.1 | PH domain-containing protein | - |
| QQ658_RS00145 (QQ658_00145) | 33967..34476 | - | 510 | WP_286025670.1 | LiaF-related protein | - |
| QQ658_RS00150 (QQ658_00150) | 34513..35010 | - | 498 | WP_286025671.1 | thiol peroxidase | - |
| QQ658_RS00155 (QQ658_00155) | 35084..35377 | - | 294 | WP_286025672.1 | putative addiction module antidote protein | Antitoxin |
| QQ658_RS00160 (QQ658_00160) | 35368..35682 | - | 315 | WP_286025673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QQ658_RS00165 (QQ658_00165) | 35827..36339 | + | 513 | WP_286025674.1 | hypothetical protein | - |
| QQ658_RS00175 (QQ658_00175) | 36478..37152 | - | 675 | WP_286025675.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| QQ658_RS00180 (QQ658_00180) | 37152..38003 | - | 852 | WP_286025676.1 | hypothetical protein | - |
| QQ658_RS00185 (QQ658_00185) | 38287..38940 | + | 654 | WP_286025677.1 | HAD hydrolase-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11992.96 Da Isoelectric Point: 10.6779
>T284229 WP_286025673.1 NZ_CP127390:c35682-35368 [Propionimicrobium sp. PCR01-08-3]
MRILRTEVYERWFRRLKDAQGKARIDIALRRCTLVGSVVGDIKPVGDGVQEMRIHSGPGYRVYFLHRPNELMLLVIGGDK
SSQSRDIEKAKAIAKQLKEEGQWR
MRILRTEVYERWFRRLKDAQGKARIDIALRRCTLVGSVVGDIKPVGDGVQEMRIHSGPGYRVYFLHRPNELMLLVIGGDK
SSQSRDIEKAKAIAKQLKEEGQWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|