Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3689277..3689814 | Replicon | chromosome |
Accession | NZ_CP127389 | ||
Organism | Proteus sp. HZ0627 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QQS39_RS16865 | Protein ID | WP_099076302.1 |
Coordinates | 3689277..3689570 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A8I0X075 |
Locus tag | QQS39_RS16870 | Protein ID | WP_023583073.1 |
Coordinates | 3689560..3689814 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQS39_RS16845 (QQS39_16845) | 3684888..3685415 | + | 528 | WP_099076296.1 | single-stranded DNA-binding protein SSB1 | - |
QQS39_RS16850 (QQS39_16850) | 3685889..3686848 | + | 960 | WP_285805007.1 | XamI family restriction endonuclease | - |
QQS39_RS16855 (QQS39_16855) | 3686851..3688413 | + | 1563 | WP_285805008.1 | N-6 DNA methylase | - |
QQS39_RS16860 (QQS39_16860) | 3688700..3689230 | + | 531 | WP_151436251.1 | zinc uptake transcriptional repressor Zur | - |
QQS39_RS16865 (QQS39_16865) | 3689277..3689570 | - | 294 | WP_099076302.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQS39_RS16870 (QQS39_16870) | 3689560..3689814 | - | 255 | WP_023583073.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QQS39_RS16875 (QQS39_16875) | 3689968..3690579 | - | 612 | WP_151436253.1 | transcriptional repressor LexA | - |
QQS39_RS16880 (QQS39_16880) | 3690707..3691078 | - | 372 | WP_151436254.1 | diacylglycerol kinase | - |
QQS39_RS16885 (QQS39_16885) | 3691209..3693692 | + | 2484 | WP_285805009.1 | glycerol-3-phosphate 1-O-acyltransferase PlsB | - |
QQS39_RS16890 (QQS39_16890) | 3693796..3694650 | - | 855 | WP_151436256.1 | 4-hydroxybenzoate octaprenyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11424.51 Da Isoelectric Point: 10.2910
>T284227 WP_099076302.1 NZ_CP127389:c3689570-3689277 [Proteus sp. HZ0627]
MIFNIEFDKRALKEWQKLDQSIKEQFKKKLKKLQENPYIESARLKGDLSGCYKIKLRASGFRLVYQIIDSEVVILVIAIG
KREESKAYSLAEMRIQK
MIFNIEFDKRALKEWQKLDQSIKEQFKKKLKKLQENPYIESARLKGDLSGCYKIKLRASGFRLVYQIIDSEVVILVIAIG
KREESKAYSLAEMRIQK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|