Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2514810..2515549 | Replicon | chromosome |
Accession | NZ_CP127389 | ||
Organism | Proteus sp. HZ0627 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | QQS39_RS11850 | Protein ID | WP_285804602.1 |
Coordinates | 2515064..2515549 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | QQS39_RS11845 | Protein ID | WP_151435479.1 |
Coordinates | 2514810..2515076 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQS39_RS11810 (QQS39_11810) | 2510461..2510943 | + | 483 | WP_006533151.1 | flagellar basal body-associated protein FliL | - |
QQS39_RS11815 (QQS39_11815) | 2510949..2511980 | + | 1032 | WP_151435474.1 | flagellar motor switch protein FliM | - |
QQS39_RS11820 (QQS39_11820) | 2511973..2512383 | + | 411 | WP_023581830.1 | flagellar motor switch protein FliN | - |
QQS39_RS11825 (QQS39_11825) | 2512387..2512833 | + | 447 | WP_151435475.1 | flagellar biosynthetic protein FliO | - |
QQS39_RS11830 (QQS39_11830) | 2512833..2513603 | + | 771 | WP_151435476.1 | flagellar type III secretion system pore protein FliP | - |
QQS39_RS11835 (QQS39_11835) | 2513619..2513888 | + | 270 | WP_151435477.1 | flagellar biosynthesis protein FliQ | - |
QQS39_RS11840 (QQS39_11840) | 2513894..2514676 | + | 783 | WP_196736676.1 | flagellar biosynthetic protein FliR | - |
QQS39_RS11845 (QQS39_11845) | 2514810..2515076 | + | 267 | WP_151435479.1 | DUF1778 domain-containing protein | Antitoxin |
QQS39_RS11850 (QQS39_11850) | 2515064..2515549 | + | 486 | WP_285804602.1 | GNAT family N-acetyltransferase | Toxin |
QQS39_RS11855 (QQS39_11855) | 2515638..2516582 | - | 945 | WP_196571542.1 | flagellar hook-associated protein FlgL | - |
QQS39_RS11860 (QQS39_11860) | 2516610..2518250 | - | 1641 | WP_285804603.1 | flagellar hook-associated protein FlgK | - |
QQS39_RS11865 (QQS39_11865) | 2518368..2519354 | - | 987 | WP_151435483.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
QQS39_RS11870 (QQS39_11870) | 2519354..2520460 | - | 1107 | WP_151435484.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17817.47 Da Isoelectric Point: 8.9704
>T284225 WP_285804602.1 NZ_CP127389:2515064-2515549 [Proteus sp. HZ0627]
MGKVTAPEPLSSSHEVADFYSSEIVLDNWIKQRGFKNQLLGASRTFVVCKENSHYVVGYYSLATGSVNHTEAINAIRRNM
PDPIPVIILARLAVDISFHGKGLGADLLRDAVLRCYHVAENIGVKAIMVHSLTENAKQFYLHNGFKASSTQENTLFLALK
K
MGKVTAPEPLSSSHEVADFYSSEIVLDNWIKQRGFKNQLLGASRTFVVCKENSHYVVGYYSLATGSVNHTEAINAIRRNM
PDPIPVIILARLAVDISFHGKGLGADLLRDAVLRCYHVAENIGVKAIMVHSLTENAKQFYLHNGFKASSTQENTLFLALK
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|