Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2184308..2185107 | Replicon | chromosome |
Accession | NZ_CP127389 | ||
Organism | Proteus sp. HZ0627 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | QQS39_RS10205 | Protein ID | WP_151435279.1 |
Coordinates | 2184308..2184832 (-) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | - |
Locus tag | QQS39_RS10210 | Protein ID | WP_099075495.1 |
Coordinates | 2184829..2185107 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQS39_RS10190 (QQS39_10190) | 2180635..2181576 | - | 942 | WP_285804457.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
QQS39_RS10200 (QQS39_10200) | 2182532..2184232 | + | 1701 | WP_151435278.1 | C4-dicarboxylic acid transporter DauA | - |
QQS39_RS10205 (QQS39_10205) | 2184308..2184832 | - | 525 | WP_151435279.1 | GNAT family N-acetyltransferase | Toxin |
QQS39_RS10210 (QQS39_10210) | 2184829..2185107 | - | 279 | WP_099075495.1 | DUF1778 domain-containing protein | Antitoxin |
QQS39_RS10215 (QQS39_10215) | 2185260..2186189 | - | 930 | WP_285804458.1 | TIGR01212 family radical SAM protein | - |
QQS39_RS10220 (QQS39_10220) | 2186198..2187052 | - | 855 | WP_109372214.1 | 3-deoxy-8-phosphooctulonate synthase | - |
QQS39_RS10225 (QQS39_10225) | 2187110..2187919 | - | 810 | WP_265576330.1 | invasion regulator SirB1 | - |
QQS39_RS10230 (QQS39_10230) | 2187903..2188751 | - | 849 | WP_285804459.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
QQS39_RS10235 (QQS39_10235) | 2188751..2189833 | - | 1083 | WP_088495429.1 | peptide chain release factor 1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19224.17 Da Isoelectric Point: 9.3652
>T284224 WP_151435279.1 NZ_CP127389:c2184832-2184308 [Proteus sp. HZ0627]
MTIPNWHEEAISKKHDRNTFNCGDAVLNQFLYRHARQNHENGSAKTYLAINTNNNIIIGYYSLCPASIEFERTPEVIARG
LARHDIPVFRLARLATDLSVQGKGLGGQLLLAAGKRCLAVASELGGVALLIDAKNERVANWYISYGAVPLLDSPLSLLIS
FKTIYTALRMANKI
MTIPNWHEEAISKKHDRNTFNCGDAVLNQFLYRHARQNHENGSAKTYLAINTNNNIIIGYYSLCPASIEFERTPEVIARG
LARHDIPVFRLARLATDLSVQGKGLGGQLLLAAGKRCLAVASELGGVALLIDAKNERVANWYISYGAVPLLDSPLSLLIS
FKTIYTALRMANKI
Download Length: 525 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|