Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 774182..774821 | Replicon | chromosome |
| Accession | NZ_CP127389 | ||
| Organism | Proteus sp. HZ0627 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QQS39_RS03595 | Protein ID | WP_196569324.1 |
| Coordinates | 774182..774586 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QQS39_RS03600 | Protein ID | WP_099074198.1 |
| Coordinates | 774579..774821 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQS39_RS03570 (QQS39_03570) | 770148..770618 | + | 471 | WP_036932916.1 | 6,7-dimethyl-8-ribityllumazine synthase | - |
| QQS39_RS03575 (QQS39_03575) | 770647..771060 | + | 414 | WP_006535124.1 | transcription antitermination factor NusB | - |
| QQS39_RS03580 (QQS39_03580) | 771164..772147 | + | 984 | WP_151434303.1 | thiamine-phosphate kinase | - |
| QQS39_RS03585 (QQS39_03585) | 772210..773106 | - | 897 | WP_285805397.1 | hypothetical protein | - |
| QQS39_RS03590 (QQS39_03590) | 773407..773742 | - | 336 | WP_109371746.1 | zinc ribbon domain-containing protein YjdM | - |
| QQS39_RS03595 (QQS39_03595) | 774182..774586 | - | 405 | WP_196569324.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| QQS39_RS03600 (QQS39_03600) | 774579..774821 | - | 243 | WP_099074198.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QQS39_RS03605 (QQS39_03605) | 774938..775936 | - | 999 | WP_285805872.1 | ribose operon transcriptional repressor RbsR | - |
| QQS39_RS03610 (QQS39_03610) | 775950..776876 | - | 927 | WP_285805398.1 | ribokinase | - |
| QQS39_RS03615 (QQS39_03615) | 776955..777845 | - | 891 | WP_151434308.1 | ribose ABC transporter substrate-binding protein RbsB | - |
| QQS39_RS03620 (QQS39_03620) | 777888..778853 | - | 966 | WP_196735400.1 | ribose ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15304.51 Da Isoelectric Point: 7.5228
>T284221 WP_196569324.1 NZ_CP127389:c774586-774182 [Proteus sp. HZ0627]
MIKYLLDTNIVIFTIKRRPEFLLPKFNQHAEQLAISTITLAELIFGAEKSLNSTKNLATVNDFVSRLTVLSYDELAAFHY
GDIRATLEKQGKRIGDNDLHIAAHARSKGLIVVTNNTREFERVDGLRIEDWTHH
MIKYLLDTNIVIFTIKRRPEFLLPKFNQHAEQLAISTITLAELIFGAEKSLNSTKNLATVNDFVSRLTVLSYDELAAFHY
GDIRATLEKQGKRIGDNDLHIAAHARSKGLIVVTNNTREFERVDGLRIEDWTHH
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|