Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/MazF-MazE |
Location | 843305..843894 | Replicon | chromosome |
Accession | NZ_CP127382 | ||
Organism | Aerococcus urinae strain UMB3669 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | DBT50_RS06690 | Protein ID | WP_111852369.1 |
Coordinates | 843541..843894 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | DBT50_RS06685 | Protein ID | WP_111852368.1 |
Coordinates | 843305..843547 (+) | Length | 81 a.a. |
Genomic Context
Location: 838429..838935 (507 bp)
Type: Others
Protein ID: WP_111852361.1
Type: Others
Protein ID: WP_111852361.1
Location: 839068..840204 (1137 bp)
Type: Others
Protein ID: WP_111852362.1
Type: Others
Protein ID: WP_111852362.1
Location: 840356..840790 (435 bp)
Type: Others
Protein ID: WP_111852363.1
Type: Others
Protein ID: WP_111852363.1
Location: 840924..841559 (636 bp)
Type: Others
Protein ID: WP_111852364.1
Type: Others
Protein ID: WP_111852364.1
Location: 842017..842364 (348 bp)
Type: Others
Protein ID: WP_111852366.1
Type: Others
Protein ID: WP_111852366.1
Location: 843305..843547 (243 bp)
Type: Antitoxin
Protein ID: WP_111852368.1
Type: Antitoxin
Protein ID: WP_111852368.1
Location: 843541..843894 (354 bp)
Type: Toxin
Protein ID: WP_111852369.1
Type: Toxin
Protein ID: WP_111852369.1
Location: 844149..844277 (129 bp)
Type: Others
Protein ID: WP_258454722.1
Type: Others
Protein ID: WP_258454722.1
Location: 844574..845971 (1398 bp)
Type: Others
Protein ID: WP_111852370.1
Type: Others
Protein ID: WP_111852370.1
Location: 846188..846616 (429 bp)
Type: Others
Protein ID: WP_111853437.1
Type: Others
Protein ID: WP_111853437.1
Location: 846609..848882 (2274 bp)
Type: Others
Protein ID: WP_111853438.1
Type: Others
Protein ID: WP_111853438.1
Location: 842485..843042 (558 bp)
Type: Others
Protein ID: WP_111852367.1
Type: Others
Protein ID: WP_111852367.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DBT50_RS06655 (DBT50_006655) | 838429..838935 | + | 507 | WP_111852361.1 | hypothetical protein | - |
DBT50_RS06660 (DBT50_006660) | 839068..840204 | + | 1137 | WP_111852362.1 | hypothetical protein | - |
DBT50_RS06665 (DBT50_006665) | 840356..840790 | + | 435 | WP_111852363.1 | GNAT family N-acetyltransferase | - |
DBT50_RS06670 (DBT50_006670) | 840924..841559 | + | 636 | WP_111852364.1 | hypothetical protein | - |
DBT50_RS06675 (DBT50_006675) | 842017..842364 | + | 348 | WP_111852366.1 | hypothetical protein | - |
DBT50_RS06680 (DBT50_006680) | 842485..843042 | - | 558 | WP_111852367.1 | isochorismatase family protein | - |
DBT50_RS06685 (DBT50_006685) | 843305..843547 | + | 243 | WP_111852368.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DBT50_RS06690 (DBT50_006690) | 843541..843894 | + | 354 | WP_111852369.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DBT50_RS06695 (DBT50_006695) | 844149..844277 | + | 129 | WP_258454722.1 | hypothetical protein | - |
DBT50_RS06700 (DBT50_006700) | 844574..845971 | + | 1398 | WP_111852370.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
DBT50_RS06705 (DBT50_006705) | 846188..846616 | + | 429 | WP_111853437.1 | MarR family transcriptional regulator | - |
DBT50_RS06710 (DBT50_006710) | 846609..848882 | + | 2274 | WP_111853438.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13883.83 Da Isoelectric Point: 9.2456
>T284219 WP_111852369.1 NZ_CP127382:843541-843894 [Aerococcus urinae]
MVMRQGDIFYVNFNPSIGHEQRNSRPAIVLSHDLIFQTSHMAIVAPISTTKRNYPAYYELQETDQIKGKVLLNQSKALDL
YHRQVSRENFIERAKPNEFQRIIHRYKLLFDLVDDYQ
MVMRQGDIFYVNFNPSIGHEQRNSRPAIVLSHDLIFQTSHMAIVAPISTTKRNYPAYYELQETDQIKGKVLLNQSKALDL
YHRQVSRENFIERAKPNEFQRIIHRYKLLFDLVDDYQ
Download Length: 354 bp