Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 455070..455641 | Replicon | chromosome |
Accession | NZ_CP127382 | ||
Organism | Aerococcus urinae strain UMB3669 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DBT50_RS04935 | Protein ID | WP_111853118.1 |
Coordinates | 455309..455641 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | DBT50_RS04930 | Protein ID | WP_111853119.1 |
Coordinates | 455070..455315 (+) | Length | 82 a.a. |
Genomic Context
Location: 455070..455315 (246 bp)
Type: Antitoxin
Protein ID: WP_111853119.1
Type: Antitoxin
Protein ID: WP_111853119.1
Location: 455309..455641 (333 bp)
Type: Toxin
Protein ID: WP_111853118.1
Type: Toxin
Protein ID: WP_111853118.1
Location: 451561..453096 (1536 bp)
Type: Others
Protein ID: WP_111853121.1
Type: Others
Protein ID: WP_111853121.1
Location: 453250..453384 (135 bp)
Type: Others
Protein ID: WP_258455373.1
Type: Others
Protein ID: WP_258455373.1
Location: 454042..454398 (357 bp)
Type: Others
Protein ID: WP_146742898.1
Type: Others
Protein ID: WP_146742898.1
Location: 455765..455929 (165 bp)
Type: Others
Protein ID: WP_216403123.1
Type: Others
Protein ID: WP_216403123.1
Location: 456406..457794 (1389 bp)
Type: Others
Protein ID: WP_111853117.1
Type: Others
Protein ID: WP_111853117.1
Location: 458547..458831 (285 bp)
Type: Others
Protein ID: WP_285936136.1
Type: Others
Protein ID: WP_285936136.1
Location: 458853..459854 (1002 bp)
Type: Others
Protein ID: WP_285936137.1
Type: Others
Protein ID: WP_285936137.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DBT50_RS04915 (DBT50_004915) | 451561..453096 | - | 1536 | WP_111853121.1 | RNA-directed DNA polymerase | - |
DBT50_RS04920 (DBT50_004920) | 453250..453384 | - | 135 | WP_258455373.1 | hypothetical protein | - |
DBT50_RS04925 (DBT50_004925) | 454042..454398 | - | 357 | WP_146742898.1 | hypothetical protein | - |
DBT50_RS04930 (DBT50_004930) | 455070..455315 | + | 246 | WP_111853119.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DBT50_RS04935 (DBT50_004935) | 455309..455641 | + | 333 | WP_111853118.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DBT50_RS04940 (DBT50_004940) | 455765..455929 | - | 165 | WP_216403123.1 | hypothetical protein | - |
DBT50_RS04945 (DBT50_004945) | 456406..457794 | - | 1389 | WP_111853117.1 | oligosaccharide flippase family protein | - |
DBT50_RS04950 (DBT50_004950) | 458547..458831 | - | 285 | WP_285936136.1 | acyltransferase family protein | - |
DBT50_RS04955 (DBT50_004955) | 458853..459854 | - | 1002 | WP_285936137.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 451561..467771 | 16210 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12768.89 Da Isoelectric Point: 9.2415
>T284218 WP_111853118.1 NZ_CP127382:455309-455641 [Aerococcus urinae]
MVKVKQGSIIKINLDPKQGHEQKGYRPYICLSHGIVTKYSNIAIFAPISNTKRKYPFYVELEHTKTTGKVLLDQLLTIDF
NARDYNYIEQVPEDILIDLLARVKVLFEKE
MVKVKQGSIIKINLDPKQGHEQKGYRPYICLSHGIVTKYSNIAIFAPISNTKRKYPFYVELEHTKTTGKVLLDQLLTIDF
NARDYNYIEQVPEDILIDLLARVKVLFEKE
Download Length: 333 bp