Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 11267..11817 | Replicon | plasmid pB |
| Accession | NZ_CP127380 | ||
| Organism | Xanthomonas fragariae strain LMG 703 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A1Y6HCU7 |
| Locus tag | OW158_RS20240 | Protein ID | WP_002804295.1 |
| Coordinates | 11267..11551 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1Y6HDJ6 |
| Locus tag | OW158_RS20245 | Protein ID | WP_002804296.1 |
| Coordinates | 11539..11817 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW158_RS20205 (OW158_20205) | 6873..7274 | - | 402 | WP_002804331.1 | hypothetical protein | - |
| OW158_RS20210 (OW158_20210) | 7326..7769 | + | 444 | WP_145954081.1 | hypothetical protein | - |
| OW158_RS20215 (OW158_20215) | 7776..7940 | + | 165 | WP_156775378.1 | hypothetical protein | - |
| OW158_RS20220 (OW158_20220) | 8128..8703 | + | 576 | WP_040762337.1 | recombinase family protein | - |
| OW158_RS20225 (OW158_20225) | 8714..8980 | + | 267 | WP_002804333.1 | hypothetical protein | - |
| OW158_RS20230 (OW158_20230) | 9178..10830 | + | 1653 | WP_231892771.1 | AAA family ATPase | - |
| OW158_RS20235 (OW158_20235) | 10899..11081 | + | 183 | WP_134656646.1 | hypothetical protein | - |
| OW158_RS20240 (OW158_20240) | 11267..11551 | - | 285 | WP_002804295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OW158_RS20245 (OW158_20245) | 11539..11817 | - | 279 | WP_002804296.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OW158_RS20250 (OW158_20250) | 12100..12789 | + | 690 | WP_231895784.1 | antitoxin VbhA family protein | - |
| OW158_RS20255 (OW158_20255) | 12831..13382 | + | 552 | WP_088057164.1 | recombinase family protein | - |
| OW158_RS20260 (OW158_20260) | 13485..14117 | + | 633 | WP_088057159.1 | ParA family protein | - |
| OW158_RS20265 (OW158_20265) | 14110..14472 | + | 363 | WP_088057160.1 | hypothetical protein | - |
| OW158_RS20270 (OW158_20270) | 14555..14878 | + | 324 | WP_088057161.1 | ParC family partition-associated protein | - |
| OW158_RS20275 (OW158_20275) | 15062..16474 | + | 1413 | WP_108817190.1 | replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..27159 | 27159 | |
| - | inside | IScluster/Tn | - | - | 8089..13382 | 5293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10801.49 Da Isoelectric Point: 10.0858
>T284216 WP_002804295.1 NZ_CP127380:c11551-11267 [Xanthomonas fragariae]
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEA
VPHLIWTPPALADVQRLYRFLAPKDADAARRAVQAIRAQVKILAHQPRIGRPVEDMAPEFRDWLIDFGDSGYVARYRINE
NMVTILAVRHQKEA
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HCU7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HDJ6 |