Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 13236..13815 | Replicon | plasmid pA |
Accession | NZ_CP127379 | ||
Organism | Xanthomonas fragariae strain LMG 703 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1Y6HD38 |
Locus tag | OW158_RS20045 | Protein ID | WP_002805372.1 |
Coordinates | 13522..13815 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1Y6HUN4 |
Locus tag | OW158_RS20040 | Protein ID | WP_002805369.1 |
Coordinates | 13236..13535 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OW158_RS20015 (OW158_20015) | 8824..10668 | + | 1845 | WP_065975501.1 | hypothetical protein | - |
OW158_RS20020 (OW158_20020) | 10665..11288 | + | 624 | WP_002805358.1 | transglycosylase SLT domain-containing protein | - |
OW158_RS20025 (OW158_20025) | 11330..11554 | + | 225 | WP_002805360.1 | DUF3717 domain-containing protein | - |
OW158_RS20030 (OW158_20030) | 11715..12290 | - | 576 | WP_065975506.1 | recombinase family protein | - |
OW158_RS20035 (OW158_20035) | 12332..13021 | - | 690 | WP_065975502.1 | antitoxin VbhA family protein | - |
OW158_RS20040 (OW158_20040) | 13236..13535 | + | 300 | WP_002805369.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OW158_RS20045 (OW158_20045) | 13522..13815 | + | 294 | WP_002805372.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OW158_RS20050 (OW158_20050) | 13893..14069 | + | 177 | WP_156775376.1 | hypothetical protein | - |
OW158_RS20055 (OW158_20055) | 14066..14290 | - | 225 | WP_002805375.1 | hypothetical protein | - |
OW158_RS20060 (OW158_20060) | 14511..15263 | + | 753 | WP_065975503.1 | hypothetical protein | - |
OW158_RS20065 (OW158_20065) | 15767..16366 | - | 600 | WP_065975504.1 | hypothetical protein | - |
OW158_RS20070 (OW158_20070) | 17024..18043 | - | 1020 | WP_052032118.1 | relaxase/mobilization nuclease domain-containing protein | - |
OW158_RS20075 (OW158_20075) | 18030..18581 | - | 552 | WP_065975505.1 | plasmid mobilization relaxosome protein MobC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..29233 | 29233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10915.49 Da Isoelectric Point: 5.1409
>T284215 WP_002805372.1 NZ_CP127379:13522-13815 [Xanthomonas fragariae]
VLVLEWRETARADLLAIVDYISDDNPDAAQRLKDDIEAKASMLPERPKLYRPGRVAGTREMVVRSNYVVVYAEDARAVSI
LRVLHAAQQWPPVTGVE
VLVLEWRETARADLLAIVDYISDDNPDAAQRLKDDIEAKASMLPERPKLYRPGRVAGTREMVVRSNYVVVYAEDARAVSI
LRVLHAAQQWPPVTGVE
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HD38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HUN4 |