Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) EcnAB/-
Location 3990638..3991004 Replicon chromosome
Accession NZ_CP127378
Organism Xanthomonas fragariae strain LMG 703

Toxin (Protein)


Gene name EcnB Uniprot ID A0A1Y6HEL5
Locus tag OW158_RS18645 Protein ID WP_002809516.1
Coordinates 3990870..3991004 (+) Length 45 a.a.

Antitoxin (Protein)


Gene name EcnA Uniprot ID A0A1Y6GQE1
Locus tag OW158_RS18640 Protein ID WP_002809518.1
Coordinates 3990638..3990790 (+) Length 51 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OW158_RS18620 (OW158_18620) 3986212..3986589 - 378 WP_231892705.1 hypothetical protein -
OW158_RS18625 (OW158_18625) 3986789..3987587 + 799 WP_088057049.1 IS5 family transposase -
OW158_RS18630 (OW158_18630) 3988849..3989248 - 400 Protein_3592 roadblock/LC7 domain-containing protein -
OW158_RS18635 (OW158_18635) 3989606..3990529 + 924 WP_002809521.1 arginase -
OW158_RS18640 (OW158_18640) 3990638..3990790 + 153 WP_002809518.1 entericidin A/B family lipoprotein Antitoxin
OW158_RS18645 (OW158_18645) 3990870..3991004 + 135 WP_002809516.1 entericidin A/B family lipoprotein Toxin
OW158_RS18650 (OW158_18650) 3991332..3992621 + 1290 WP_002809514.1 tryptophan--tRNA ligase -
OW158_RS18655 (OW158_18655) 3992804..3993004 + 201 Protein_3597 peptidase M20 -
OW158_RS18660 (OW158_18660) 3993165..3993770 + 606 Protein_3598 drug/metabolite exporter YedA -
OW158_RS18665 (OW158_18665) 3993786..3994695 + 910 Protein_3599 EamA family transporter RarD -
OW158_RS18670 (OW158_18670) 3994755..3995870 - 1116 WP_088057050.1 alpha/beta fold hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Entericidin A/B

(23-42)

Antitoxin

Entericidin A/B

(23-42)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4425.27 Da        Isoelectric Point: 10.2040

>T284213 WP_002809516.1 NZ_CP127378:3990870-3991004 [Xanthomonas fragariae]
MKRAIVLLVLSVLSVGILSGCNTVAGAGKDVKGAGEKVEDAARK

Download         Length: 135 bp

Antitoxin


Download         Length: 51 a.a.        Molecular weight: 5241.20 Da        Isoelectric Point: 9.4952

>AT284213 WP_002809518.1 NZ_CP127378:3990638-3990790 [Xanthomonas fragariae]
MKRLLTLMVLGLFSAGVMTGCNTFAGAGKDMQRAGSKVEKKADNCSDGKC

Download         Length: 153 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Y6HEL5

Antitoxin

Source ID Structure
AlphaFold DB A0A1Y6GQE1

References