Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2069222..2069892 | Replicon | chromosome |
| Accession | NZ_CP127378 | ||
| Organism | Xanthomonas fragariae strain LMG 703 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1Y6H9H7 |
| Locus tag | OW158_RS09680 | Protein ID | WP_002805728.1 |
| Coordinates | 2069473..2069892 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1Y6HLT7 |
| Locus tag | OW158_RS09675 | Protein ID | WP_002805732.1 |
| Coordinates | 2069222..2069476 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OW158_RS09650 (OW158_09650) | 2064807..2065802 | - | 996 | WP_231892738.1 | LuxR family transcriptional regulator | - |
| OW158_RS09655 (OW158_09655) | 2065893..2066126 | + | 234 | WP_002805742.1 | hypothetical protein | - |
| OW158_RS09660 (OW158_09660) | 2066130..2067008 | + | 879 | WP_002805739.1 | helicase RepA family protein | - |
| OW158_RS09665 (OW158_09665) | 2066980..2067867 | + | 888 | WP_172404498.1 | replication protein C, IncQ-type | - |
| OW158_RS09670 (OW158_09670) | 2068529..2068810 | + | 282 | WP_002805735.1 | TraK family protein | - |
| OW158_RS09675 (OW158_09675) | 2069222..2069476 | + | 255 | WP_002805732.1 | Arc family DNA-binding protein | Antitoxin |
| OW158_RS09680 (OW158_09680) | 2069473..2069892 | + | 420 | WP_002805728.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OW158_RS09685 (OW158_09685) | 2070049..2070660 | + | 612 | Protein_1853 | P-type conjugative transfer protein TrbJ | - |
| OW158_RS09690 (OW158_09690) | 2070749..2070991 | + | 243 | Protein_1854 | transposase | - |
| OW158_RS09695 (OW158_09695) | 2071109..2072475 | + | 1367 | Protein_1855 | IS5 family transposase | - |
| OW158_RS09700 (OW158_09700) | 2072498..2073403 | + | 906 | Protein_1856 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2036507..2072379 | 35872 | |
| - | flank | IS/Tn | - | - | 2063396..2064733 | 1337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14879.07 Da Isoelectric Point: 5.1890
>T284212 WP_002805728.1 NZ_CP127378:2069473-2069892 [Xanthomonas fragariae]
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
MIVLDTNVVSEAIKPEPNPAVRAWLNEQVAETLYLSSVTLAELLFGIGALPNGKRKKGLGEALDGLLELFGERVLMFDTE
AARHYAELAVKARTAGKGFPTPDGYIGAIAASKGFIVATRDTSPFEAAGLTVINPWNHQ
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6H9H7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Y6HLT7 |