Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2291191..2292181 | Replicon | chromosome |
Accession | NZ_CP127376 | ||
Organism | Bacillus arachidis strain YX15 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A2C2U8G0 |
Locus tag | QRY57_RS13250 | Protein ID | WP_026590827.1 |
Coordinates | 2291191..2291931 (+) | Length | 247 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | QRY57_RS13255 | Protein ID | WP_026590828.1 |
Coordinates | 2292053..2292181 (+) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRY57_RS13230 (QRY57_13235) | 2287294..2287623 | - | 330 | WP_026590823.1 | DUF1232 domain-containing protein | - |
QRY57_RS13235 (QRY57_13240) | 2288124..2289434 | + | 1311 | WP_026590824.1 | DEAD/DEAH box helicase | - |
QRY57_RS13240 (QRY57_13245) | 2289606..2290082 | + | 477 | WP_286017684.1 | MarR family transcriptional regulator | - |
QRY57_RS13245 (QRY57_13250) | 2290259..2290993 | + | 735 | WP_286017685.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
QRY57_RS13250 (QRY57_13255) | 2291191..2291931 | + | 741 | WP_026590827.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QRY57_RS13255 (QRY57_13260) | 2292053..2292181 | + | 129 | WP_026590828.1 | hypothetical protein | Antitoxin |
QRY57_RS13260 (QRY57_13265) | 2292258..2292434 | + | 177 | WP_286017686.1 | stage II sporulation protein SB | - |
QRY57_RS13265 (QRY57_13270) | 2292450..2292836 | - | 387 | WP_170833630.1 | GNAT family N-acetyltransferase | - |
QRY57_RS13270 (QRY57_13275) | 2293026..2294492 | + | 1467 | WP_286017687.1 | aminoacyl-histidine dipeptidase | - |
QRY57_RS13275 (QRY57_13280) | 2295377..2295628 | + | 252 | WP_286017688.1 | hypothetical protein | - |
QRY57_RS13280 (QRY57_13285) | 2295831..2296556 | + | 726 | WP_286017689.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 247 a.a. Molecular weight: 28363.15 Da Isoelectric Point: 8.6877
>T284211 WP_026590827.1 NZ_CP127376:2291191-2291931 [Bacillus arachidis]
MTVSNIRIGLFFLVLVFLFLIFFYWKNEELYEEKKQLIRKTWYGVFITSVTIYFMVKGIDLTLWKNILMFVAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPVAFGTMEWQTETEYAKSLNVFLDTYGEKIGAK
IVVFVTANELNTNFRGIRSQFSITVPLEHIEQLNAQKAVQVENVGIIPAKIVKDVCIVIDGQKNNLQDRDFENVYNLTIH
HSYFSK
MTVSNIRIGLFFLVLVFLFLIFFYWKNEELYEEKKQLIRKTWYGVFITSVTIYFMVKGIDLTLWKNILMFVAMVIFVDIA
FILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPVAFGTMEWQTETEYAKSLNVFLDTYGEKIGAK
IVVFVTANELNTNFRGIRSQFSITVPLEHIEQLNAQKAVQVENVGIIPAKIVKDVCIVIDGQKNNLQDRDFENVYNLTIH
HSYFSK
Download Length: 741 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|