Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 242856..243498 | Replicon | chromosome |
| Accession | NZ_CP127376 | ||
| Organism | Bacillus arachidis strain YX15 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | QRY57_RS03000 | Protein ID | WP_000635965.1 |
| Coordinates | 243148..243498 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8PTJ6 |
| Locus tag | QRY57_RS02995 | Protein ID | WP_000004571.1 |
| Coordinates | 242856..243143 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRY57_RS02970 (QRY57_02975) | 238718..239680 | + | 963 | WP_026592770.1 | UV DNA damage repair endonuclease UvsE | - |
| QRY57_RS02975 (QRY57_02980) | 239684..240244 | - | 561 | WP_081811071.1 | rhomboid family intramembrane serine protease | - |
| QRY57_RS02980 (QRY57_02985) | 240337..240696 | + | 360 | WP_026592771.1 | holo-ACP synthase | - |
| QRY57_RS02985 (QRY57_02990) | 240853..241800 | + | 948 | WP_141527996.1 | outer membrane lipoprotein carrier protein LolA | - |
| QRY57_RS02990 (QRY57_02995) | 241920..242540 | + | 621 | Protein_229 | alanine racemase | - |
| QRY57_RS02995 (QRY57_03000) | 242856..243143 | + | 288 | WP_000004571.1 | antitoxin EndoAI | Antitoxin |
| QRY57_RS03000 (QRY57_03005) | 243148..243498 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QRY57_RS03005 (QRY57_03010) | 243564..245732 | + | 2169 | WP_286016632.1 | Tex family protein | - |
| QRY57_RS03010 (QRY57_03015) | 245836..245952 | - | 117 | WP_090694145.1 | cortex morphogenetic protein CmpA | - |
| QRY57_RS03015 (QRY57_03020) | 246208..246693 | + | 486 | WP_286016633.1 | SprT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T284210 WP_000635965.1 NZ_CP127376:243148-243498 [Bacillus arachidis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8PTJ6 |