Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/- |
Location | 2817511..2818235 | Replicon | chromosome |
Accession | NZ_CP127364 | ||
Organism | Paracidovorax citrulli strain KACC 17001 |
Toxin (Protein)
Gene name | avrRxo1 | Uniprot ID | - |
Locus tag | QRO11_RS12825 | Protein ID | WP_233423719.1 |
Coordinates | 2817511..2817924 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | arc1 | Uniprot ID | A1TRP1 |
Locus tag | QRO11_RS12830 | Protein ID | WP_011796139.1 |
Coordinates | 2817939..2818235 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRO11_RS12805 (QRO11_12805) | 2813340..2815544 | - | 2205 | WP_041828059.1 | TOMM precursor leader peptide-binding protein | - |
QRO11_RS12810 (QRO11_12810) | 2815758..2816027 | - | 270 | WP_225981105.1 | hypothetical protein | - |
QRO11_RS12815 (QRO11_12815) | 2816125..2816676 | + | 552 | WP_233427208.1 | XopAJ/AvrRxo1 family type III secretion system effector zeta toxin | - |
QRO11_RS12820 (QRO11_12820) | 2816683..2817495 | - | 813 | WP_011793283.1 | IS5 family transposase | - |
QRO11_RS12825 (QRO11_12825) | 2817511..2817924 | + | 414 | WP_233423719.1 | hypothetical protein | Toxin |
QRO11_RS12830 (QRO11_12830) | 2817939..2818235 | + | 297 | WP_011796139.1 | hypothetical protein | Antitoxin |
QRO11_RS12835 (QRO11_12835) | 2818394..2819248 | - | 855 | WP_232521745.1 | class I SAM-dependent methyltransferase | - |
QRO11_RS12840 (QRO11_12840) | 2819258..2820055 | - | 798 | WP_011796141.1 | BMA_0021/BMA_0022 family TOMM bacteriocin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2816683..2817495 | 812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14544.26 Da Isoelectric Point: 6.3243
>T284209 WP_233423719.1 NZ_CP127364:2817511-2817924 [Paracidovorax citrulli]
MTSTPRSKVHNTLYVAVANGFSAVRGHRLDVIDKFLSNPTLGSYHLFGTTGNGSKAMVASVVNGELSIHDPQLYEAITDP
QGARAGDSGDQIIDAALIDRLTKGIDDPARAMDARTALERYAGMTWSDALAAHSSLT
MTSTPRSKVHNTLYVAVANGFSAVRGHRLDVIDKFLSNPTLGSYHLFGTTGNGSKAMVASVVNGELSIHDPQLYEAITDP
QGARAGDSGDQIIDAALIDRLTKGIDDPARAMDARTALERYAGMTWSDALAAHSSLT
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|