Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 613951..614584 | Replicon | chromosome |
Accession | NZ_CP127362 | ||
Organism | Paracidovorax citrulli strain KACC 17913 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A1TJP6 |
Locus tag | QRO12_RS02895 | Protein ID | WP_011793755.1 |
Coordinates | 614171..614584 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B0DRJ9 |
Locus tag | QRO12_RS02890 | Protein ID | WP_041827216.1 |
Coordinates | 613951..614184 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRO12_RS02890 (QRO12_02890) | 613951..614184 | + | 234 | WP_041827216.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QRO12_RS02895 (QRO12_02895) | 614171..614584 | + | 414 | WP_011793755.1 | PIN domain-containing protein | Toxin |
QRO12_RS02900 (QRO12_02900) | 614605..614967 | + | 363 | WP_011793756.1 | DUF3742 family protein | - |
QRO12_RS02905 (QRO12_02905) | 614981..616495 | - | 1515 | WP_011793757.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
QRO12_RS02910 (QRO12_02910) | 617180..617752 | + | 573 | WP_011793758.1 | aminodeoxychorismate/anthranilate synthase component II | - |
QRO12_RS02915 (QRO12_02915) | 617824..618507 | + | 684 | WP_011793759.1 | LysE family translocator | - |
QRO12_RS02920 (QRO12_02920) | 618540..619577 | + | 1038 | WP_011793760.1 | anthranilate phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 400396..656368 | 255972 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15147.48 Da Isoelectric Point: 6.2136
>T284205 WP_011793755.1 NZ_CP127362:614171-614584 [Paracidovorax citrulli]
MAAGKGKVFLDSNVVLYLLSEDAAKADSAEALLHRRPVISVQVLNEVTHVCVRKLKMGWGEVGQFLALVREFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
MAAGKGKVFLDSNVVLYLLSEDAAKADSAEALLHRRPVISVQVLNEVTHVCVRKLKMGWGEVGQFLALVREFCSIVPLTV
EVHDRARQLAERHQLSFYDACIVAAAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A1TJP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0DRJ9 |