Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/- |
Location | 2056755..2057989 | Replicon | chromosome |
Accession | NZ_CP127361 | ||
Organism | Paracidovorax citrulli strain KACC 18782 |
Toxin (Protein)
Gene name | avrRxo1 | Uniprot ID | - |
Locus tag | QRO09_RS09305 | Protein ID | WP_232521744.1 |
Coordinates | 2056755..2057678 (+) | Length | 308 a.a. |
Antitoxin (Protein)
Gene name | arc1 | Uniprot ID | A1TRP1 |
Locus tag | QRO09_RS09310 | Protein ID | WP_011796139.1 |
Coordinates | 2057693..2057989 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRO09_RS09280 (QRO09_09280) | 2052328..2052666 | - | 339 | WP_011796135.1 | hypothetical protein | - |
QRO09_RS09285 (QRO09_09285) | 2052688..2052816 | - | 129 | WP_258868820.1 | hypothetical protein | - |
QRO09_RS09290 (QRO09_09290) | 2052982..2053905 | - | 924 | WP_228193810.1 | FHA domain-containing protein | - |
QRO09_RS09295 (QRO09_09295) | 2053970..2056156 | - | 2187 | WP_228193811.1 | TOMM precursor leader peptide-binding protein | - |
QRO09_RS09300 (QRO09_09300) | 2056388..2056657 | - | 270 | WP_225981105.1 | hypothetical protein | - |
QRO09_RS09305 (QRO09_09305) | 2056755..2057678 | + | 924 | WP_232521744.1 | XopAJ/AvrRxo1 family type III secretion system effector zeta toxin | Toxin |
QRO09_RS09310 (QRO09_09310) | 2057693..2057989 | + | 297 | WP_011796139.1 | hypothetical protein | Antitoxin |
QRO09_RS09315 (QRO09_09315) | 2058148..2059002 | - | 855 | WP_232521745.1 | class I SAM-dependent methyltransferase | - |
QRO09_RS09320 (QRO09_09320) | 2059012..2059809 | - | 798 | WP_011796141.1 | BMA_0021/BMA_0022 family TOMM bacteriocin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 308 a.a. Molecular weight: 32876.16 Da Isoelectric Point: 6.2340
>T284203 WP_232521744.1 NZ_CP127361:2056755-2057678 [Paracidovorax citrulli]
MAHPQNWRPERRQLHDRLIGDAKTAAQDFAEVIERGGHPPTLFALRGNTAAGKTRMATQTIPVLANALKESGGAGCINPD
IFKRSLAETPEGAKLTSAQVHAESCILADRLEDELRLQKTASGAAISMLVDKRLAGAHEIDAYIKLAQETGRKIELCDID
APLEQSLMGVLQRKPEGDAPRPPYVAVANGFSAVRGHRLDVIDKFLSNPTLGSYHLFGTTGNGSKAMVASVVNGELSIHD
PQLYEAITDPQGARAGDSGDQIIDAALIDRLTKGIDDPARAMDARTALERYAGMTWSDALAAHSSLT
MAHPQNWRPERRQLHDRLIGDAKTAAQDFAEVIERGGHPPTLFALRGNTAAGKTRMATQTIPVLANALKESGGAGCINPD
IFKRSLAETPEGAKLTSAQVHAESCILADRLEDELRLQKTASGAAISMLVDKRLAGAHEIDAYIKLAQETGRKIELCDID
APLEQSLMGVLQRKPEGDAPRPPYVAVANGFSAVRGHRLDVIDKFLSNPTLGSYHLFGTTGNGSKAMVASVVNGELSIHD
PQLYEAITDPQGARAGDSGDQIIDAALIDRLTKGIDDPARAMDARTALERYAGMTWSDALAAHSSLT
Download Length: 924 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|