Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/- |
Location | 2102744..2103978 | Replicon | chromosome |
Accession | NZ_CP127360 | ||
Organism | Paracidovorax citrulli strain KACC 18784 |
Toxin (Protein)
Gene name | avrRxo1 | Uniprot ID | - |
Locus tag | QRO10_RS09570 | Protein ID | WP_232521744.1 |
Coordinates | 2102744..2103667 (+) | Length | 308 a.a. |
Antitoxin (Protein)
Gene name | arc1 | Uniprot ID | A1TRP1 |
Locus tag | QRO10_RS09575 | Protein ID | WP_011796139.1 |
Coordinates | 2103682..2103978 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRO10_RS09545 (QRO10_09545) | 2098317..2098655 | - | 339 | WP_011796135.1 | hypothetical protein | - |
QRO10_RS09550 (QRO10_09550) | 2098677..2098805 | - | 129 | WP_258868820.1 | hypothetical protein | - |
QRO10_RS09555 (QRO10_09555) | 2098971..2099894 | - | 924 | WP_228193810.1 | FHA domain-containing protein | - |
QRO10_RS09560 (QRO10_09560) | 2099959..2102163 | - | 2205 | WP_041828059.1 | TOMM precursor leader peptide-binding protein | - |
QRO10_RS09565 (QRO10_09565) | 2102377..2102646 | - | 270 | WP_225981105.1 | hypothetical protein | - |
QRO10_RS09570 (QRO10_09570) | 2102744..2103667 | + | 924 | WP_232521744.1 | XopAJ/AvrRxo1 family type III secretion system effector zeta toxin | Toxin |
QRO10_RS09575 (QRO10_09575) | 2103682..2103978 | + | 297 | WP_011796139.1 | hypothetical protein | Antitoxin |
QRO10_RS09580 (QRO10_09580) | 2104137..2104991 | - | 855 | WP_232521745.1 | class I SAM-dependent methyltransferase | - |
QRO10_RS09585 (QRO10_09585) | 2105001..2105798 | - | 798 | WP_011796141.1 | BMA_0021/BMA_0022 family TOMM bacteriocin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 308 a.a. Molecular weight: 32876.16 Da Isoelectric Point: 6.2340
>T284201 WP_232521744.1 NZ_CP127360:2102744-2103667 [Paracidovorax citrulli]
MAHPQNWRPERRQLHDRLIGDAKTAAQDFAEVIERGGHPPTLFALRGNTAAGKTRMATQTIPVLANALKESGGAGCINPD
IFKRSLAETPEGAKLTSAQVHAESCILADRLEDELRLQKTASGAAISMLVDKRLAGAHEIDAYIKLAQETGRKIELCDID
APLEQSLMGVLQRKPEGDAPRPPYVAVANGFSAVRGHRLDVIDKFLSNPTLGSYHLFGTTGNGSKAMVASVVNGELSIHD
PQLYEAITDPQGARAGDSGDQIIDAALIDRLTKGIDDPARAMDARTALERYAGMTWSDALAAHSSLT
MAHPQNWRPERRQLHDRLIGDAKTAAQDFAEVIERGGHPPTLFALRGNTAAGKTRMATQTIPVLANALKESGGAGCINPD
IFKRSLAETPEGAKLTSAQVHAESCILADRLEDELRLQKTASGAAISMLVDKRLAGAHEIDAYIKLAQETGRKIELCDID
APLEQSLMGVLQRKPEGDAPRPPYVAVANGFSAVRGHRLDVIDKFLSNPTLGSYHLFGTTGNGSKAMVASVVNGELSIHD
PQLYEAITDPQGARAGDSGDQIIDAALIDRLTKGIDDPARAMDARTALERYAGMTWSDALAAHSSLT
Download Length: 924 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|