Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 150527..151170 Replicon plasmid pCh101
Accession NZ_CP127318
Organism Escherichia coli strain Ch1

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QRM71_RS27540 Protein ID WP_001034044.1
Coordinates 150754..151170 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QRM71_RS27535 Protein ID WP_001261286.1
Coordinates 150527..150757 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM71_RS27505 (QRM71_27505) 145712..146128 - 417 WP_001278818.1 plasmid partitioning/stability family protein -
QRM71_RS27510 (QRM71_27510) 146121..147101 - 981 WP_285978936.1 plasmid segregation protein ParM -
QRM71_RS27515 (QRM71_27515) 147515..147823 - 309 WP_000048808.1 hypothetical protein -
QRM71_RS27520 (QRM71_27520) 147910..148554 - 645 WP_001144036.1 ParA family protein -
QRM71_RS27525 (QRM71_27525) 148734..149513 - 780 WP_097416723.1 site-specific integrase -
QRM71_RS27530 (QRM71_27530) 149515..149928 - 414 WP_097416722.1 hypothetical protein -
QRM71_RS27535 (QRM71_27535) 150527..150757 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRM71_RS27540 (QRM71_27540) 150754..151170 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QRM71_RS27545 (QRM71_27545) 151245..152809 + 1565 Protein_174 AAA family ATPase -
QRM71_RS27550 (QRM71_27550) 152794..153815 + 1022 Protein_175 DNA helicase UvrD -
QRM71_RS27555 (QRM71_27555) 154069..154755 - 687 Protein_176 IS1 family transposase -
QRM71_RS27560 (QRM71_27560) 154812..155754 - 943 Protein_177 integrase core domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - cnf / cnf1 / cnf1 / vat / vat 1..156007 156007


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T284200 WP_001034044.1 NZ_CP127318:150754-151170 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT284200 WP_001261286.1 NZ_CP127318:150527-150757 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References