Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 49994..50529 Replicon plasmid pCh101
Accession NZ_CP127318
Organism Escherichia coli strain Ch1

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag QRM71_RS26955 Protein ID WP_000222760.1
Coordinates 49994..50281 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag QRM71_RS26960 Protein ID WP_001132900.1
Coordinates 50278..50529 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM71_RS26925 (QRM71_26925) 45408..45797 + 390 WP_062894334.1 cytochrome b562 -
QRM71_RS26930 (QRM71_26930) 46049..47037 + 989 Protein_51 IS3 family transposase -
QRM71_RS26935 (QRM71_26935) 47011..47508 + 498 WP_032297276.1 ATP-binding cassette domain-containing protein -
QRM71_RS26940 (QRM71_26940) 48160..48474 - 315 WP_000633742.1 hypothetical protein -
QRM71_RS26945 (QRM71_26945) 48532..49197 - 666 WP_000536047.1 ProQ/FINO family protein -
QRM71_RS26950 (QRM71_26950) 49300..49890 - 591 WP_103556655.1 serine acetyltransferase -
QRM71_RS26955 (QRM71_26955) 49994..50281 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRM71_RS26960 (QRM71_26960) 50278..50529 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QRM71_RS26965 (QRM71_26965) 50602..50792 - 191 Protein_58 hypothetical protein -
QRM71_RS26970 (QRM71_26970) 51485..52357 - 873 WP_000729438.1 incFII family plasmid replication initiator RepA -
QRM71_RS26975 (QRM71_26975) 53195..53701 + 507 WP_024187405.1 transcription termination/antitermination NusG family protein -
QRM71_RS26980 (QRM71_26980) 53842..54507 + 666 WP_021547664.1 hypothetical protein -
QRM71_RS26985 (QRM71_26985) 54862..55104 + 243 WP_059330908.1 PilI type IV pilus biogenesis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - cnf / cnf1 / cnf1 / vat / vat 1..156007 156007
- flank IS/Tn - - 46049..46414 365


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T284199 WP_000222760.1 NZ_CP127318:c50281-49994 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT284199 WP_001132900.1 NZ_CP127318:c50529-50278 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References