Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 30499..31142 Replicon plasmid pCh101
Accession NZ_CP127318
Organism Escherichia coli strain Ch1

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QRM71_RS26840 Protein ID WP_001034046.1
Coordinates 30726..31142 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QRM71_RS26835 Protein ID WP_001261278.1
Coordinates 30499..30729 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM71_RS26820 (QRM71_26820) 27640..29178 - 1539 WP_000997971.1 IS66-like element ISEc8 family transposase -
QRM71_RS26825 (QRM71_26825) 29228..29575 - 348 Protein_30 IS66 family insertion sequence element accessory protein TnpB -
QRM71_RS26830 (QRM71_26830) 29572..29952 - 381 WP_001171554.1 transposase -
QRM71_RS26835 (QRM71_26835) 30499..30729 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRM71_RS26840 (QRM71_26840) 30726..31142 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QRM71_RS26845 (QRM71_26845) 31367..31837 + 471 Protein_34 transposase -
QRM71_RS26850 (QRM71_26850) 31844..32119 + 276 Protein_35 recombinase family protein -
QRM71_RS26855 (QRM71_26855) 32573..33136 - 564 WP_062894304.1 pentapeptide repeat-containing protein -
QRM71_RS26860 (QRM71_26860) 33298..33984 - 687 Protein_37 IS1 family transposase -
QRM71_RS26865 (QRM71_26865) 34013..34468 - 456 WP_062894303.1 hypothetical protein -
QRM71_RS26870 (QRM71_26870) 34649..35861 + 1213 Protein_39 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - cnf / cnf1 / cnf1 / vat / vat 1..156007 156007
- inside IScluster/Tn - - 16204..35861 19657


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T284198 WP_001034046.1 NZ_CP127318:30726-31142 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT284198 WP_001261278.1 NZ_CP127318:30499-30729 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References