Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 5315831..5316536 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | QRM71_RS25870 | Protein ID | WP_000539521.1 |
| Coordinates | 5316150..5316536 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QRM71_RS25865 | Protein ID | WP_001280945.1 |
| Coordinates | 5315831..5316160 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS25850 (5310989) | 5310989..5311900 | + | 912 | WP_001236018.1 | glutathione ABC transporter permease GsiD | - |
| QRM71_RS25855 (5312078) | 5312078..5314425 | + | 2348 | Protein_5048 | EAL domain-containing protein | - |
| QRM71_RS25860 (5314433) | 5314433..5315761 | + | 1329 | WP_032352848.1 | GGDEF domain-containing protein | - |
| QRM71_RS25865 (5315831) | 5315831..5316160 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| QRM71_RS25870 (5316150) | 5316150..5316536 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRM71_RS25875 (5316762) | 5316762..5318087 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| QRM71_RS25880 (5318300) | 5318300..5318683 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| QRM71_RS25885 (5318794) | 5318794..5319909 | + | 1116 | WP_000555050.1 | aldose sugar dehydrogenase YliI | - |
| QRM71_RS25890 (5319906) | 5319906..5320532 | - | 627 | WP_032352846.1 | glutathione S-transferase GstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T284189 WP_000539521.1 NZ_CP127316:c5316536-5316150 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|