Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4171493..4172328 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A2S4A272 |
| Locus tag | QRM71_RS20430 | Protein ID | WP_001094443.1 |
| Coordinates | 4171951..4172328 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7LDN9 |
| Locus tag | QRM71_RS20425 | Protein ID | WP_001285607.1 |
| Coordinates | 4171493..4171861 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS20390 (4167414) | 4167414..4168094 | + | 681 | WP_136695573.1 | WYL domain-containing protein | - |
| QRM71_RS20395 (4168242) | 4168242..4168919 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QRM71_RS20400 (4168949) | 4168949..4169158 | + | 210 | WP_032150870.1 | DUF905 family protein | - |
| QRM71_RS20405 (4169248) | 4169248..4170066 | + | 819 | WP_094392407.1 | DUF932 domain-containing protein | - |
| QRM71_RS20410 (4170158) | 4170158..4170643 | + | 486 | WP_094392406.1 | antirestriction protein | - |
| QRM71_RS20415 (4170659) | 4170659..4171135 | + | 477 | WP_001560678.1 | RadC family protein | - |
| QRM71_RS20420 (4171198) | 4171198..4171419 | + | 222 | WP_077516876.1 | DUF987 domain-containing protein | - |
| QRM71_RS20425 (4171493) | 4171493..4171861 | + | 369 | WP_001285607.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM71_RS20430 (4171951) | 4171951..4172328 | + | 378 | WP_001094443.1 | TA system toxin CbtA family protein | Toxin |
| QRM71_RS20435 (4172325) | 4172325..4172813 | + | 489 | WP_000761685.1 | DUF5983 family protein | - |
| QRM71_RS20440 (4172833) | 4172833..4173030 | + | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| QRM71_RS20445 (4173115) | 4173115..4173258 | + | 144 | Protein_3993 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB / fimE / fimA / fimI / fimC | 4153723..4189056 | 35333 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.97 Da Isoelectric Point: 7.3523
>T284185 WP_001094443.1 NZ_CP127316:4171951-4172328 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13689.53 Da Isoelectric Point: 6.4669
>AT284185 WP_001285607.1 NZ_CP127316:4171493-4171861 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S4A272 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0JLU8 |