Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4081212..4081734 | Replicon | chromosome |
Accession | NZ_CP127316 | ||
Organism | Escherichia coli strain Ch1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A829L6G8 |
Locus tag | QRM71_RS19945 | Protein ID | WP_001105433.1 |
Coordinates | 4081444..4081734 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0D8WJ36 |
Locus tag | QRM71_RS19940 | Protein ID | WP_000212718.1 |
Coordinates | 4081212..4081454 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM71_RS19920 (4077125) | 4077125..4078498 | + | 1374 | WP_001219792.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
QRM71_RS19925 (4078581) | 4078581..4079132 | - | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
QRM71_RS19930 (4079226) | 4079226..4080578 | + | 1353 | WP_001162176.1 | metalloprotease PmbA | - |
QRM71_RS19935 (4080634) | 4080634..4081020 | + | 387 | WP_001232253.1 | cytochrome b562 | - |
QRM71_RS19940 (4081212) | 4081212..4081454 | + | 243 | WP_000212718.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QRM71_RS19945 (4081444) | 4081444..4081734 | + | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRM71_RS19950 (4081735) | 4081735..4082199 | - | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QRM71_RS19955 (4082379) | 4082379..4084517 | - | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QRM71_RS19960 (4084911) | 4084911..4086566 | - | 1656 | WP_032353022.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T284184 WP_001105433.1 NZ_CP127316:4081444-4081734 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829L6G8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D8WJ36 |