Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3923943..3924812 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0U4BLW2 |
| Locus tag | QRM71_RS19150 | Protein ID | WP_059309235.1 |
| Coordinates | 3923943..3924353 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0X5FMN2 |
| Locus tag | QRM71_RS19155 | Protein ID | WP_039023579.1 |
| Coordinates | 3924444..3924812 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS19130 (3920345) | 3920345..3921883 | - | 1539 | WP_001187178.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| QRM71_RS19135 (3922632) | 3922632..3923473 | - | 842 | Protein_3736 | DUF4942 domain-containing protein | - |
| QRM71_RS19140 (3923558) | 3923558..3923755 | - | 198 | WP_085975623.1 | DUF957 domain-containing protein | - |
| QRM71_RS19145 (3923831) | 3923831..3923980 | - | 150 | Protein_3738 | DUF5983 family protein | - |
| QRM71_RS19150 (3923943) | 3923943..3924353 | - | 411 | WP_059309235.1 | TA system toxin CbtA family protein | Toxin |
| QRM71_RS19155 (3924444) | 3924444..3924812 | - | 369 | WP_039023579.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM71_RS19160 (3924862) | 3924862..3925496 | - | 635 | Protein_3741 | antitoxin of toxin-antitoxin stability system | - |
| QRM71_RS19165 (3925515) | 3925515..3925736 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| QRM71_RS19170 (3925799) | 3925799..3926275 | - | 477 | WP_001366830.1 | RadC family protein | - |
| QRM71_RS19175 (3926291) | 3926291..3926770 | - | 480 | WP_000860074.1 | antirestriction protein | - |
| QRM71_RS19180 (3926852) | 3926852..3927670 | - | 819 | WP_001234688.1 | DUF932 domain-containing protein | - |
| QRM71_RS19185 (3927856) | 3927856..3928740 | - | 885 | WP_000010380.1 | YfjP family GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3912856..3961580 | 48724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15234.33 Da Isoelectric Point: 6.8522
>T284182 WP_059309235.1 NZ_CP127316:c3924353-3923943 [Escherichia coli]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQH
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQH
Download Length: 411 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13672.49 Da Isoelectric Point: 6.7393
>AT284182 WP_039023579.1 NZ_CP127316:c3924812-3924444 [Escherichia coli]
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0U4BLW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0X5FMN2 |