Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2688200..2689032 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | F4TJC5 |
| Locus tag | QRM71_RS13375 | Protein ID | WP_001094452.1 |
| Coordinates | 2688200..2688574 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | F4TJC4 |
| Locus tag | QRM71_RS13380 | Protein ID | WP_001285579.1 |
| Coordinates | 2688664..2689032 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS13340 (2683344) | 2683344..2683607 | - | 264 | Protein_2618 | hypothetical protein | - |
| QRM71_RS13345 (2683753) | 2683753..2683962 | - | 210 | WP_001049623.1 | helix-turn-helix domain-containing protein | - |
| QRM71_RS13350 (2684105) | 2684105..2684821 | - | 717 | WP_240089060.1 | hypothetical protein | - |
| QRM71_RS13355 (2684814) | 2684814..2686235 | - | 1422 | WP_160377695.1 | integrase family protein | - |
| QRM71_RS13360 (2686561) | 2686561..2687406 | - | 846 | WP_021539310.1 | DUF4942 domain-containing protein | - |
| QRM71_RS13365 (2687503) | 2687503..2687700 | - | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
| QRM71_RS13370 (2687712) | 2687712..2688203 | - | 492 | WP_000976868.1 | DUF5983 family protein | - |
| QRM71_RS13375 (2688200) | 2688200..2688574 | - | 375 | WP_001094452.1 | TA system toxin CbtA family protein | Toxin |
| QRM71_RS13380 (2688664) | 2688664..2689032 | - | 369 | WP_001285579.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM71_RS13385 (2689112) | 2689112..2689333 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QRM71_RS13390 (2689396) | 2689396..2689872 | - | 477 | WP_001186706.1 | RadC family protein | - |
| QRM71_RS13395 (2689888) | 2689888..2690373 | - | 486 | WP_285978918.1 | antirestriction protein | - |
| QRM71_RS13400 (2690465) | 2690465..2691283 | - | 819 | WP_001564116.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2660724..2713619 | 52895 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14014.86 Da Isoelectric Point: 7.2920
>T284179 WP_001094452.1 NZ_CP127316:c2688574-2688200 [Escherichia coli]
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13580.39 Da Isoelectric Point: 7.3223
>AT284179 WP_001285579.1 NZ_CP127316:c2689032-2688664 [Escherichia coli]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYLAVYPTSETKK
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYLAVYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z7YIM6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7Z8DWX2 |