Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2524646..2525428 Replicon chromosome
Accession NZ_CP127316
Organism Escherichia coli strain Ch1

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QRM71_RS12570 Protein ID WP_285978910.1
Coordinates 2525054..2525428 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QRM71_RS12565 Protein ID WP_285978909.1
Coordinates 2524646..2525008 (+) Length 121 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM71_RS12530 (2520476) 2520476..2521360 + 885 WP_001696588.1 50S ribosome-binding GTPase -
QRM71_RS12535 (2521479) 2521479..2522156 + 678 WP_001097365.1 hypothetical protein -
QRM71_RS12540 (2522162) 2522162..2522314 + 153 WP_285978908.1 DUF905 family protein -
QRM71_RS12545 (2522415) 2522415..2523233 + 819 WP_001234688.1 DUF932 domain-containing protein -
QRM71_RS12550 (2523315) 2523315..2523794 + 480 WP_000860074.1 antirestriction protein -
QRM71_RS12555 (2523810) 2523810..2524286 + 477 WP_001366830.1 RadC family protein -
QRM71_RS12560 (2524349) 2524349..2524570 + 222 WP_000692323.1 DUF987 domain-containing protein -
QRM71_RS12565 (2524646) 2524646..2525008 + 363 WP_285978909.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QRM71_RS12570 (2525054) 2525054..2525428 + 375 WP_285978910.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QRM71_RS12575 (2525428) 2525428..2525644 + 217 Protein_2466 DUF5983 family protein -
QRM71_RS12580 (2525587) 2525587..2525769 + 183 Protein_2467 hypothetical protein -
QRM71_RS12585 (2525854) 2525854..2526696 + 843 WP_285978911.1 DUF4942 domain-containing protein -
QRM71_RS12590 (2527039) 2527039..2527209 + 171 Protein_2469 IS110 family transposase -
QRM71_RS12595 (2528020) 2528020..2529003 + 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
QRM71_RS12600 (2529075) 2529075..2530223 + 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2527054..2527209 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(13-112)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14083.24 Da        Isoelectric Point: 8.4983

>T284178 WP_285978910.1 NZ_CP127316:2525054-2525428 [Escherichia coli]
MKTLPVLPKQAASSRPSPLEIWQILLTRLLDQHYGLTLHDTPFADERMIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 121 a.a.        Molecular weight: 13195.94 Da        Isoelectric Point: 5.4549

>AT284178 WP_285978909.1 NZ_CP127316:2524646-2525008 [Escherichia coli]
VSDTLPDDNHDRPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSGELNPR
HQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPAVPATTA

Download         Length: 363 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References