Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2391320..2391974 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | QRM71_RS11870 | Protein ID | WP_000244781.1 |
| Coordinates | 2391320..2391727 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QRM71_RS11875 | Protein ID | WP_000354046.1 |
| Coordinates | 2391708..2391974 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS11850 (2387277) | 2387277..2389010 | - | 1734 | WP_000813226.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QRM71_RS11855 (2389016) | 2389016..2389726 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QRM71_RS11860 (2389751) | 2389751..2390647 | - | 897 | WP_000806650.1 | site-specific tyrosine recombinase XerD | - |
| QRM71_RS11865 (2390759) | 2390759..2391280 | + | 522 | WP_001055865.1 | flavodoxin FldB | - |
| QRM71_RS11870 (2391320) | 2391320..2391727 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| QRM71_RS11875 (2391708) | 2391708..2391974 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QRM71_RS11880 (2392217) | 2392217..2393197 | + | 981 | WP_001562036.1 | tRNA-modifying protein YgfZ | - |
| QRM71_RS11885 (2393274) | 2393274..2393933 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
| QRM71_RS11890 (2394097) | 2394097..2394408 | - | 312 | WP_001182951.1 | N(4)-acetylcytidine aminohydrolase | - |
| QRM71_RS11895 (2394453) | 2394453..2395886 | + | 1434 | WP_001559758.1 | 6-phospho-beta-glucosidase BglA | - |
| QRM71_RS11900 (2395948) | 2395948..2396691 | - | 744 | WP_032353540.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T284177 WP_000244781.1 NZ_CP127316:c2391727-2391320 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|