Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 2243971..2244554 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | QRM71_RS11195 | Protein ID | WP_000254738.1 |
| Coordinates | 2243971..2244306 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | QRM71_RS11200 | Protein ID | WP_000581937.1 |
| Coordinates | 2244306..2244554 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS11180 (2239857) | 2239857..2241155 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| QRM71_RS11185 (2241243) | 2241243..2242880 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| QRM71_RS11190 (2243108) | 2243108..2243899 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| QRM71_RS11195 (2243971) | 2243971..2244306 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| QRM71_RS11200 (2244306) | 2244306..2244554 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QRM71_RS11205 (2244632) | 2244632..2246866 | - | 2235 | WP_001551562.1 | GTP diphosphokinase | - |
| QRM71_RS11210 (2246914) | 2246914..2248215 | - | 1302 | WP_001578884.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T284176 WP_000254738.1 NZ_CP127316:c2244306-2243971 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|