Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1096546..1097378 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0D8W767 |
| Locus tag | QRM71_RS05610 | Protein ID | WP_000854697.1 |
| Coordinates | 1097004..1097378 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0D8WAR2 |
| Locus tag | QRM71_RS05605 | Protein ID | WP_001354195.1 |
| Coordinates | 1096546..1096914 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS05565 (1091739) | 1091739..1092623 | + | 885 | WP_001696588.1 | 50S ribosome-binding GTPase | - |
| QRM71_RS05570 (1092742) | 1092742..1093419 | + | 678 | WP_001097365.1 | hypothetical protein | - |
| QRM71_RS05575 (1093425) | 1093425..1093577 | + | 153 | WP_001696589.1 | DUF905 family protein | - |
| QRM71_RS05580 (1093678) | 1093678..1094496 | + | 819 | WP_001234688.1 | DUF932 domain-containing protein | - |
| QRM71_RS05585 (1094578) | 1094578..1095057 | + | 480 | WP_000860074.1 | antirestriction protein | - |
| QRM71_RS05590 (1095073) | 1095073..1095549 | + | 477 | WP_001354455.1 | RadC family protein | - |
| QRM71_RS05595 (1095612) | 1095612..1095833 | + | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
| QRM71_RS05600 (1095852) | 1095852..1096496 | + | 645 | WP_045146861.1 | hypothetical protein | - |
| QRM71_RS05605 (1096546) | 1096546..1096914 | + | 369 | WP_001354195.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM71_RS05610 (1097004) | 1097004..1097378 | + | 375 | WP_000854697.1 | TA system toxin CbtA family protein | Toxin |
| QRM71_RS05615 (1097375) | 1097375..1097527 | + | 153 | Protein_1109 | DUF5983 family protein | - |
| QRM71_RS05620 (1097603) | 1097603..1097800 | + | 198 | WP_085975623.1 | DUF957 domain-containing protein | - |
| QRM71_RS05625 (1097885) | 1097885..1098681 | + | 797 | Protein_1111 | DUF4942 domain-containing protein | - |
| QRM71_RS05635 (1100237) | 1100237..1101403 | + | 1167 | WP_032353119.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14023.07 Da Isoelectric Point: 7.1881
>T284170 WP_000854697.1 NZ_CP127316:1097004-1097378 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFADERVIELHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFADERVIELHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13708.48 Da Isoelectric Point: 6.8270
>AT284170 WP_001354195.1 NZ_CP127316:1096546-1096914 [Escherichia coli]
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLPMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHHDDNHDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHPDQAFPLPMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8W767 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D8WAR2 |