Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 602913..603551 | Replicon | chromosome |
| Accession | NZ_CP127316 | ||
| Organism | Escherichia coli strain Ch1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0D8WF76 |
| Locus tag | QRM71_RS03090 | Protein ID | WP_001306887.1 |
| Coordinates | 602913..603089 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QRM71_RS03095 | Protein ID | WP_001270286.1 |
| Coordinates | 603135..603551 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM71_RS03070 (598535) | 598535..599746 | - | 1212 | WP_071791157.1 | BenE family transporter YdcO | - |
| QRM71_RS03075 (599799) | 599799..600335 | + | 537 | WP_000429136.1 | DNA-binding transcriptional regulator SutR | - |
| QRM71_RS03080 (600408) | 600408..602369 | + | 1962 | WP_024166512.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QRM71_RS03085 (602461) | 602461..602691 | - | 231 | WP_000494241.1 | YncJ family protein | - |
| QRM71_RS03090 (602913) | 602913..603089 | + | 177 | WP_001306887.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QRM71_RS03095 (603135) | 603135..603551 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QRM71_RS03100 (603630) | 603630..605036 | + | 1407 | WP_279957258.1 | PLP-dependent aminotransferase family protein | - |
| QRM71_RS03105 (605281) | 605281..606426 | + | 1146 | WP_000047452.1 | ABC transporter substrate-binding protein | - |
| QRM71_RS03110 (606444) | 606444..607457 | + | 1014 | WP_089619990.1 | ABC transporter ATP-binding protein | - |
| QRM71_RS03115 (607458) | 607458..608399 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6768.88 Da Isoelectric Point: 11.5336
>T284167 WP_001306887.1 NZ_CP127316:602913-603089 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFRGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT284167 WP_001270286.1 NZ_CP127316:603135-603551 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|