Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 220605..221389 | Replicon | chromosome |
Accession | NZ_CP127316 | ||
Organism | Escherichia coli strain Ch1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | QRM71_RS01130 | Protein ID | WP_000613626.1 |
Coordinates | 220605..221099 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | QRM71_RS01135 | Protein ID | WP_001110447.1 |
Coordinates | 221096..221389 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM71_RS01110 (215798) | 215798..216895 | + | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
QRM71_RS01115 (216895) | 216895..217836 | + | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
QRM71_RS01120 (217902) | 217902..219545 | + | 1644 | WP_285978847.1 | flagellar hook-associated protein FlgK | - |
QRM71_RS01125 (219557) | 219557..220510 | + | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
QRM71_RS01130 (220605) | 220605..221099 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
QRM71_RS01135 (221096) | 221096..221389 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
QRM71_RS01140 (221522) | 221522..224707 | - | 3186 | WP_285978848.1 | ribonuclease E | - |
QRM71_RS01145 (225280) | 225280..226239 | + | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T284162 WP_000613626.1 NZ_CP127316:c221099-220605 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|