Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4826555..4827390 | Replicon | chromosome |
| Accession | NZ_CP127314 | ||
| Organism | Escherichia coli strain C25 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QRM69_RS23405 | Protein ID | WP_000854759.1 |
| Coordinates | 4826555..4826932 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QRM69_RS23410 | Protein ID | WP_001295723.1 |
| Coordinates | 4827022..4827390 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM69_RS23380 (4822666) | 4822666..4824288 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QRM69_RS23385 (4824950) | 4824950..4825255 | - | 306 | Protein_4567 | helix-turn-helix domain-containing protein | - |
| QRM69_RS23390 (4825622) | 4825622..4825771 | - | 150 | Protein_4568 | hypothetical protein | - |
| QRM69_RS23395 (4825877) | 4825877..4826053 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QRM69_RS23400 (4826070) | 4826070..4826558 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QRM69_RS23405 (4826555) | 4826555..4826932 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QRM69_RS23410 (4827022) | 4827022..4827390 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM69_RS23415 (4827553) | 4827553..4827774 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QRM69_RS23420 (4827837) | 4827837..4828313 | - | 477 | WP_001186775.1 | RadC family protein | - |
| QRM69_RS23425 (4828329) | 4828329..4828802 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| QRM69_RS23430 (4829144) | 4829144..4829962 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QRM69_RS23435 (4830080) | 4830080..4830275 | - | 196 | Protein_4577 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4816267..4841926 | 25659 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T284158 WP_000854759.1 NZ_CP127314:c4826932-4826555 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT284158 WP_001295723.1 NZ_CP127314:c4827390-4827022 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |