Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4427082..4427880 | Replicon | chromosome |
| Accession | NZ_CP127314 | ||
| Organism | Escherichia coli strain C25 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q8VRA6 |
| Locus tag | QRM69_RS21440 | Protein ID | WP_000854730.1 |
| Coordinates | 4427503..4427880 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P0SQV8 |
| Locus tag | QRM69_RS21435 | Protein ID | WP_001285481.1 |
| Coordinates | 4427082..4427456 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM69_RS21395 (4423058) | 4423058..4423510 | + | 453 | WP_000682723.1 | hypothetical protein | - |
| QRM69_RS21400 (4423628) | 4423628..4423861 | + | 234 | WP_001213776.1 | DUF905 family protein | - |
| QRM69_RS21405 (4423961) | 4423961..4424781 | + | 821 | Protein_4181 | DUF932 domain-containing protein | - |
| QRM69_RS21410 (4424781) | 4424781..4425026 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| QRM69_RS21415 (4425120) | 4425120..4425593 | + | 474 | WP_001313575.1 | antirestriction protein | - |
| QRM69_RS21420 (4425609) | 4425609..4426085 | + | 477 | WP_001313574.1 | RadC family protein | - |
| QRM69_RS21425 (4426148) | 4426148..4426369 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| QRM69_RS21430 (4426388) | 4426388..4427032 | + | 645 | WP_286005099.1 | antitoxin of toxin-antitoxin stability system | - |
| QRM69_RS21435 (4427082) | 4427082..4427456 | + | 375 | WP_001285481.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM69_RS21440 (4427503) | 4427503..4427880 | + | 378 | WP_000854730.1 | TA system toxin CbtA family protein | Toxin |
| QRM69_RS21445 (4427877) | 4427877..4428369 | + | 493 | Protein_4189 | DUF5983 family protein | - |
| QRM69_RS21450 (4428448) | 4428448..4429436 | - | 989 | Protein_4190 | IS630 family transposase | - |
| QRM69_RS21455 (4429584) | 4429584..4429772 | - | 189 | Protein_4191 | IS66 family transposase | - |
| QRM69_RS21460 (4429833) | 4429833..4430966 | + | 1134 | WP_000555401.1 | IS110-like element ISEc45 family transposase | - |
| QRM69_RS21465 (4431220) | 4431220..4432624 | - | 1405 | Protein_4193 | IS66 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14212.21 Da Isoelectric Point: 7.2923
>T284154 WP_000854730.1 NZ_CP127314:4427503-4427880 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13817.53 Da Isoelectric Point: 4.7511
>AT284154 WP_001285481.1 NZ_CP127314:4427082-4427456 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V671 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P0SQV8 |