Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4128028..4128646 | Replicon | chromosome |
| Accession | NZ_CP127314 | ||
| Organism | Escherichia coli strain C25 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QRM69_RS20050 | Protein ID | WP_001291435.1 |
| Coordinates | 4128428..4128646 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QRM69_RS20045 | Protein ID | WP_000344800.1 |
| Coordinates | 4128028..4128402 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM69_RS20035 (4123118) | 4123118..4124311 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QRM69_RS20040 (4124334) | 4124334..4127483 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| QRM69_RS20045 (4128028) | 4128028..4128402 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QRM69_RS20050 (4128428) | 4128428..4128646 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QRM69_RS20055 (4128819) | 4128819..4129370 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QRM69_RS20060 (4129486) | 4129486..4129956 | + | 471 | WP_001304825.1 | YlaC family protein | - |
| QRM69_RS20065 (4130120) | 4130120..4131670 | + | 1551 | WP_001528761.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QRM69_RS20070 (4131712) | 4131712..4132065 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QRM69_RS20080 (4132444) | 4132444..4132755 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QRM69_RS20085 (4132786) | 4132786..4133358 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T284153 WP_001291435.1 NZ_CP127314:4128428-4128646 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT284153 WP_000344800.1 NZ_CP127314:4128028-4128402 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |